Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331197-20 20 µl $263 
LS-C331197-50 50 µl $301 
LS-C331197-100 100 µl $359 
LS-C331197-200 200 µl $473 
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat brain using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat liver using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded mouse spleen using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat spleen using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded human esophageal tissue.
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded mouse testis using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat lung using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunofluorescence analysis of HeLa cells using ARRB1 antibody. Blue: DAPI for nuclear staining.
ARRB1 / Beta Arrestin 1 Antibody - Western blot analysis of extracts of various cell lines, using ARRB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
ARRB1 / Beta Arrestin 1 Antibody - Western blot analysis of extracts of various cell lines, using ARRB1 antibody.
ARRB1 / Beta Arrestin 1 Antibody - Immunoprecipitation analysis of 200ug extracts of K-562 cells, using 3 ug ARRB1 antibody. Western blot was performed from the immunoprecipitate using ARRB1 antibodyat a dilition of 1:1000.
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat brain using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat liver using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded mouse spleen using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat spleen using ARRB1 antibodyat dilution of 1:100 (40x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded human esophageal tissue.
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded mouse testis using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat kidney tissue.
ARRB1 / Beta Arrestin 1 Antibody - Immunohistochemistry of paraffin-embedded rat lung using ARRB1 antibody at dilution of 1:100 (200x lens).
ARRB1 / Beta Arrestin 1 Antibody - Immunofluorescence analysis of HeLa cells using ARRB1 antibody. Blue: DAPI for nuclear staining.
ARRB1 / Beta Arrestin 1 Antibody - Western blot analysis of extracts of various cell lines, using ARRB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
ARRB1 / Beta Arrestin 1 Antibody - Western blot analysis of extracts of various cell lines, using ARRB1 antibody.
ARRB1 / Beta Arrestin 1 Antibody - Immunoprecipitation analysis of 200ug extracts of K-562 cells, using 3 ug ARRB1 antibody. Western blot was performed from the immunoprecipitate using ARRB1 antibodyat a dilition of 1:1000.
1 of 13
2 of 13
3 of 13
4 of 13
5 of 13
6 of 13
7 of 13
8 of 13
9 of 13
10 of 13
11 of 13
12 of 13
13 of 13

Polyclonal Rabbit anti‑Human ARRB1 / Beta Arrestin 1 Antibody (IHC, IF, WB) LS‑C331197

Polyclonal Rabbit anti‑Human ARRB1 / Beta Arrestin 1 Antibody (IHC, IF, WB) LS‑C331197

Antibody:
ARRB1 / Beta Arrestin 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331197-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ARRB1 / Beta Arrestin 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Beta Arrestin 1 antibody LS-C331197 is an unconjugated rabbit polyclonal antibody to Beta Arrestin 1 (ARRB1) from human. It is reactive with human and mouse. Validated for IF, IHC, IP and WB.
Target
Human ARRB1 / Beta Arrestin 1
Synonyms
ARRB1 | Arrestin 2 | Arrestin beta-1 | Arb1 | ARR1 | Beta-arrestin-1 | Arrestin, beta 1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 169-418 of human ARRB1 (NP_004032.2). RKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Specificity
Human ARRB1 / Beta Arrestin 1
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:20 - 1:100)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 46kDa/47kDa, while the observed MW by Western blot was 56kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARRB1 / Beta Arrestin 1
P49407 NM_004041 NP_004032.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/27/2022