Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334032-20 20 µl $263 
LS-C334032-50 50 µl (1.84 mg/ml) $289 
LS-C334032-100 100 µl $343 
LS-C334032-200 200 µl $439 
ANXA6/Annexin A6/Annexin VI Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
ANXA6/Annexin A6/Annexin VI Antibody - Immunofluorescence analysis of A549 cells.
ANXA6/Annexin A6/Annexin VI Antibody - Western blot analysis of extracts of various cell lines.
ANXA6/Annexin A6/Annexin VI Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
ANXA6/Annexin A6/Annexin VI Antibody - Immunofluorescence analysis of A549 cells.
ANXA6/Annexin A6/Annexin VI Antibody - Western blot analysis of extracts of various cell lines.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human ANXA6/Annexin A6/Annexin VI Antibody (IHC, IF, WB) LS‑C334032

Polyclonal Rabbit anti‑Human ANXA6/Annexin A6/Annexin VI Antibody (IHC, IF, WB) LS‑C334032

Antibody:
ANXA6/Annexin A6/Annexin VI Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334032-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ANXA6/Annexin A6/Annexin VI Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Annexin VI antibody LS-C334032 is an unconjugated rabbit polyclonal antibody to Annexin VI (ANXA6 / Annexin A6) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
Target
Human ANXA6/Annexin A6/Annexin VI
Synonyms
ANXA6 | 67 kDa calelectrin | Annexin VI (p68) | Annexin A6 | Annexin VI | ANX6 | Calcium-binding protein p68 | Calelectrin | CBP68 | Chromobindin-20 | Calphobindin-II | Lipocortin VI | p70 | Protein III | Annexin-6 | Calphobindin II | CPB-II | p68
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ANXA6 (NP_001146.2). MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR
Specificity
Human ANXA6/Annexin A6/Annexin VI.
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 72kDa/75kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ANXA6/Annexin A6/Annexin VI
P08133 NM_001155 NP_001146.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022