LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-VSX2 / CHX10 Antibody (aa261-314) LS-C68218


Wt. Vol. Conc. Price
250 µg - - $635
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular VSX2 / CHX10 Antibodies

Anti-VSX2 / CHX10 Antibody (aa2-135, FITC) LS-C302542
Rabbit Polyclonal (IgG) to Mouse VSX2 / CHX10
Western blot, ELISA
FITC Conjugated
Western blot Image
Anti-VSX2 / CHX10 Antibody (aa2-135, FITC) LS-C302543
Rabbit Polyclonal (IgG) to Human VSX2 / CHX10
Western blot, ELISA
FITC Conjugated
Western blot Image
Anti-VSX2 / CHX10 Antibody (aa2-135, FITC) LS-C302545
Rabbit Polyclonal (IgG) to Rat VSX2 / CHX10
Western blot, ELISA
FITC Conjugated

100% Guaranteed 100% Guaranteed
Sheep Polyclonal (IgG) to Human VSX2 / CHX10
Human, Mouse, Rat
Western blot


Human VSX2 / CHX10
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal


Western blot (0.5 - 1 µg/ml)

Specificity and Use

VSX2 / CHX10 antibody was raised against recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10.
Recognizes human HOX10. Species cross-reactivity: Mouse, rat and bovine.
Suitable for use in Western Blot. Western Blot: 0.5-1 ug/ml. Detects a band of approximately 46kD in mouse and rat retinal tissue lysates. Positive control: Rat or mouse retinal tissue lysate.


PBS, 0.08% sodium azide.
For research use only.

About VSX2 / CHX10

P58304 NM_182894 NP_878314.1

VSX2 Antibody, CHX10 Antibody, Homeobox protein CHX10 Antibody, MCOP2 Antibody, MCOPCB3 Antibody, RET1 Antibody, HOX10 Antibody, Visual system homeobox 2 Antibody

Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells.

Requested From: United States
Date Requested: 2/21/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number