LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-VEGFA / VEGF Antibody LS-C204251


Wt. Vol. Conc. Price
600 µg 200 µl 3 mg/ml $355
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular VEGFA / VEGF Antibodies

Anti-VEGFA / VEGF Antibody (clone VG76e) LS-C2929
Mouse Monoclonal [clone VG76e] (IgG1) to Human VEGFA / VEGF
Human, Bovine, Pig, Sheep
IHC - Paraffin, Western blot, Immunoprecipitation, ELISA
Western blot Image
Anti-VEGFA / VEGF Antibody LS-C104581
Rabbit Polyclonal to Human VEGFA / VEGF
IHC, Western blot, ELISA, Neutralization
Immunohistochemistry Image
Anti-VEGFA / VEGF Antibody (clone VG-1) IHC-plus™ LS-B3579
Mouse Monoclonal [clone VG-1] (IgG1) to Human VEGFA / VEGF
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal (IgG) to Human VEGFA / VEGF
Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Donkey
Immunofluorescence, Western blot


Human, Monkey, Mouse, Rat, Bovine, Cat, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Donkey (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified


  • Immunofluorescence (1:50 - 1:250)
  • Western blot (1:500 - 1:2000)

Specificity and Use

VEGFA / VEGF antibody was raised against purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.


PBS, 20% glycerol, 0.05% sodium azide.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For research use only.


P15692 NM_003376 NP_003367.4

VEGFA Antibody, VPF Antibody, Vascular permeability factor Antibody, VEGF Antibody, VEGF-A Antibody, MVCD1 Antibody

VEGFA / VEGF is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis.


Immunofluorescence. Immunostaining of primary RPE cells using VEGFA antibody at 1:50 dilution.

Western blot

Western blot
Western blot. MBP-VEGFA isoform 6 recombinant protein detected by WB using anti-VEGFA antibody at 1000 dilution. Rabbit polyclonal to goat IgG (HRP) at 1:10000 dilution.

Requested From: United States
Date Requested: 12/4/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number