LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-TRAIL-R3 / DCR1 Antibody (aa33-63) LS-C83942

Note: This antibody replaces LS-C18135, LS-C14815


Wt. Vol. Conc. Price
200 µg - - $455
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular TRAIL-R3 / DCR1 Antibodies

Anti-TRAIL-R3 / DCR1 Antibody (clone DJR3, PE) LS-C106229
Mouse Monoclonal [clone DJR3] (IgG1,k) to Human TRAIL-R3 / DCR1
Flow Cytometry
PE Conjugated
Flow Cytometry Image
Anti-TRAIL-R3 / DCR1 Antibody (aa1-280, clone TRAIL-R3-02) LS-C355225
Mouse Monoclonal [clone TRAIL-R3-02] (IgG1) to Human TRAIL-R3 / DCR1
Flow Cytometry

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Human TRAIL-R3 / DCR1
IHC, ICC, Western blot, Flow Cytometry, ELISA


Human TRAIL-R3 / DCR1
Human (tested or 100% immunogen sequence identity)
Immunoaffinity purified


  • IHC
  • ICC
  • Western blot
  • Flow Cytometry
  • ELISA (1:150000)

Specificity and Use

TRAIL-R3 / DCR1 antibody was raised against synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1). Percent identity by BLAST analysis: Human, Gorilla (100%); Orangutan (87%); Marmoset (84%).
This antibody recognizes human TRAIL-3 receptor and may cross-react with mouse TRAIL-R3 as Western blotting shows a similar size protein of ~33 kD from mouse spleen. TRAIL-R2 peptide from the same region does not bind to this antibody. For TRAIL-R1 there is low sequence homology in this region. This antibody may bind to TRAIL-R4.


Phosphate buffered saline, 0.1% sodium azide
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
For research use only.

About TRAIL-R3 / DCR1

O14798 NM_003841 NP_003832.2

TNFRSF10C Antibody, CD263 antigen Antibody, CD263 Antibody, Cytotoxic TRAIL receptor-3 Antibody, Decoy receptor 1 Antibody, DCR1 Antibody, DCR1-TNFR Antibody, LIT Antibody, Lymphocyte inhibitor of TRAIL Antibody, TRAIL-R3 Antibody, TRAILR3 Antibody, TRAIL receptor 3 Antibody, TRID Antibody

Apoptosis is induced by certain cytokines including TNF and Fas ligand in the TNF family through their death domain containing receptors. TRAIL/Apo2L is a new member of the TNF family and induces apoptosis of a variety of tumor cell lines. DR4 and DR5 are the recently identified functional receptors for TRAIL. Two decoy receptors for TRAIL have been identified and designated DcR1/TRID/TRAIL-R3/LIT and DcR2/TRAIL-R4/TRUNDD.

Requested From: United States
Date Requested: 12/2/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number