LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-TLR8 Antibody (aa81-109) LS-C83989


Wt. Vol. Conc. Price
200 µg - - Unavailable

Most Popular TLR8 Antibodies

Anti-TLR8 Antibody (Internal) IHC-plus™ LS-B430
Rabbit Polyclonal to Human TLR8
Human, Mouse
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-TLR8 Antibody IHC-plus™ LS-B1421
Rabbit Polyclonal to Human TLR8
Human, Mouse
IHC - Paraffin, ICC, Western blot
Immunohistochemistry Image
Anti-TLR8 Antibody (aa750-850, clone 44C143) IHC-plus™ LS-B2248
Mouse Monoclonal [clone 44C143] (IgG1,k) to Human TLR8
Human, Mouse
IHC - Paraffin, Western blot, Flow Cytometry
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Human TLR8
ICC, Western blot


Human TLR8
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
Immunoaffinity purified


  • ICC (1:200)
  • Western blot

Specificity and Use

TLR8 antibody was raised against 30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey (93%); Marmoset (86%).
Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.


Phosphate buffered saline, 1 mg/ml BSA, 0.1% sodium azide
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
For research use only.

About TLR8

Q9NR97 NM_138636 NP_619542.1

TLR8 Antibody, CD288 Antibody, Toll-like receptor 8 Antibody, CD288 antigen Antibody

Toll-like receptors (TLRs) are signaling molecules that recognize different microbial products during infection and serve as an important link between the innate and adaptive immune responses. These proteins act through adaptor molecules such as MyD88 and TIRAP to activate various kinases and transcription factors. Like TLR7, TLR8 is localized to endosomal or lysosomal compartments and stimulates the innate immune response after activation by guanosine- and uridine-rich single-stranded RNA.

Requested From: 
Date Requested: 3/23/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number