LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-TLR5 Antibody (aa151-181) LS-C83963

Note: This antibody replaces LS-C90577, LS-C10746, LS-C10745


Wt. Vol. Conc. Price
200 µg - - Unavailable

Most Popular TLR5 Antibodies

Anti-TLR5 Antibody (Internal) IHC-plus™ LS-B601
Rabbit Polyclonal to Human TLR5
Human, Mouse, Rat
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-TLR5 Antibody (C-Terminus) IHC-plus™ LS-B1418
Rabbit Polyclonal to Human TLR5
Human, Mouse
IHC - Paraffin, ICC, Western blot
Immunohistochemistry Image
Anti-TLR5 Antibody (aa71-102) LS-C98275
Rabbit Polyclonal to Mouse TLR5
Mouse, Human
IHC - Paraffin, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Human TLR5
IHC, ICC, Western blot, Flow Cytometry, ELISA


Human TLR5
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
Immunoaffinity purified


  • IHC (1:125)
  • ICC (1:250)
  • Western blot (1:100)
  • Flow Cytometry (1:50)
  • ELISA (1:35000)

Specificity and Use

TLR5 antibody was raised against synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%); Colobus monkey, Baboon (97%); Marmoset (94%); Sheep, Goat, Panda, Water buffalo (84%); Zebu, Bovine (81%).
Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.


Phosphate buffered saline, 1 mg/ml BSA, 0.1% sodium azide
Long term: -70°C; Short term: -20°C; Avoid freeze-thaw cycles.
For research use only.

About TLR5

O60602 NM_003268 BAB43955.1

TLR5 Antibody, TIL3 Antibody, Toll-like receptor 5 Antibody, SLEB1 Antibody

TLR5 is a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor.

Requested From: 
Date Requested: 3/26/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number