LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-TLR4 Antibody (aa161-192) LS-C187853


Wt. Vol. Conc. Price
100 µg - 1 mg/ml $375
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular TLR4 Antibodies

Anti-TLR4 Antibody (Internal) IHC-plus™ LS-A9704
Rabbit Polyclonal to Human TLR4
IHC - Paraffin
Immunohistochemistry Image
Anti-TLR4 Antibody (aa100-200, clone 76B357.1) IHC-plus™ LS-B2070
Mouse Monoclonal [clone 76B357.1] (IgG2b,k) to Human TLR4
Human, Mouse, Rat
IHC - Paraffin, Western blot, Flow Cytometry
Immunohistochemistry Image
Anti-TLR4 Antibody (clone HTA125, PE, Cy7) LS-C107190
Mouse Monoclonal [clone HTA125] (IgG2a,k) to Human TLR4
Flow Cytometry
PE, Cy7 Conjugated
Flow Cytometry Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal (IgG) to Human TLR4
Human, Mouse
IHC - Paraffin, Western blot


Human TLR4
Human, Mouse (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
IgG Polyclonal
Affinity purified


  • IHC - Paraffin (1:100 - 1:300)
  • Western blot (1:1000)

Specificity and Use

TLR4 antibody was raised against synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Hamster (87%); Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%); Panda, Cat, Pig (81%).
Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.


PBS, 0.1% sodium azide, 0.1% BSA
+4°C or -20°C, Avoid repeated freezing and thawing.
For research use only.

About TLR4

O00206 NM_138554 O00206

TLR4 Antibody, CD284 Antibody, CD284 antigen Antibody, Homolog of Drosophila toll Antibody, TLR-4 Antibody, TOLL Antibody, ARMD10 Antibody, Toll-like receptor 4 Antibody, HToll Antibody

Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni2+. Responses triggered by Ni2+ require non-conserved histidines and are, therefore, species-specific.


Immunohistochemistry of paraffin-embeddedi mouse spleen stained with Goat anti-human CD284


Immunohistochemistry of paraffin-embeddedi human tonsil stained with Goat anti-human CD284

Requested From: United States
Date Requested: 2/20/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number