LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-TFF1 / pS2 Antibody (aa54-84, clone pS2.1) IHC-plus™ LS-B9347

Note: This antibody replaces LS-C87539


Wt. Vol. Conc. Price
- 250 µl 0.2 mg/ml $450
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular TFF1 / pS2 Antibodies

Anti-TFF1 / pS2 Antibody (aa54-84, clone pS2.1, Azide-free) LS-C87549
Mouse Monoclonal [clone pS2.1] (IgG1) to Human TFF1 / pS2
Unconjugated, Azide-free
Anti-TFF1 / pS2 Antibody IHC-plus™ LS-B7746
Rabbit Polyclonal (IgG) to Human TFF1 / pS2
Human, Rat
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-TFF1 / pS2 Antibody LS-C155659
Rabbit Polyclonal (IgG) to Human TFF1 / pS2
IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone pS2.1] (IgG1) to Human TFF1 / pS2
IHC - Paraffin


Human TFF1 / pS2
Human (tested or 100% immunogen sequence identity)
IgG1 Monoclonal [pS2.1]
Protein G purified


IHC - Paraffin (10 µg/ml)

Specificity and Use

TFF1 / pS2 antibody was raised against a Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein. Percent identity by BLAST analysis: Human (100%); Monkey (87%).


10mM PBS, pH 7.4, with 0.2% BSA and 0.09% Sodium Azide
Stable for 24 months when stored at 2-8°C.
For research use only.

About TFF1 / pS2

P04155 NM_003225 NP_003216.1

TFF1 Antibody, BCEI Antibody, D21S21 Antibody, HPS2 Antibody, PNR-2 Antibody, Polypeptide P1.A Antibody, Protein pS2 Antibody, PS2 Antibody, HP1.A Antibody, Trefoil factor 1 Antibody

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. TFF1, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors.


Anti-TFF1 / PS2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.

Requested From: United States
Date Requested: 2/21/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number