• Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-STAT1 Antibody (aa712-750) LS-C39256

Catalog Size Price
LS-C39256-100 100 µg Unavailable

Related Products

161 STAT1 Antibodies

Most Popular STAT1 Antibodies

Anti-STAT1 Antibody (phospho-Tyr701) LS-C10368
Rabbit Polyclonal (IgG) to Mouse STAT1
Western blot
Anti-STAT1 Antibody (C-Terminus) LS-C30470
Rabbit Polyclonal (IgG) to Human STAT1
Human, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep
Western blot
Western blot Image
Anti-STAT1 Antibody (C-Terminus) IHC-plus™ LS-B591
Rabbit Polyclonal (IgG) to Human STAT1
Human, Mouse, Rat
IHC - Paraffin, ICC, Western blot, Immunoprecipitation
Immunohistochemistry Image
Anti-STAT1 Antibody (clone SM1) IHC-plus™ LS-B1874
Mouse Monoclonal [clone SM1] (IgG2b) to Human STAT1
Human, Monkey, Mouse, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep
IHC - Paraffin, Western blot, Immunoprecipitation
Immunohistochemistry Image
Anti-STAT1 Antibody (N-Terminus) IHC-plus™ LS-B4583
Rabbit Polyclonal (IgG) to Human STAT1
Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish
IHC - Paraffin, Western blot
Immunohistochemistry Image

100% Guaranteed
Rabbit Polyclonal (IgG) to Human STAT1
Human, Dog, Horse
Western blot, Immunoprecipitation

Human STAT1
Human, Dog, Horse (tested or 100% immunogen sequence identity)
Monkey, Bat, Bovine, Pig, Sheep (at least 90% immunogen sequence identity)
IgG Polyclonal

  • Western blot
  • Immunoprecipitation

Specificity and Use

STAT1 antibody was raised against a 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the human STAT1alpha (residues 712-750) was synthesized and the peptide coupled to KLH. The sequence differs from that of mouse by four amino acids. The carboxy terminal 38. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Panda, Dog, Horse (100%); Marmoset, Sheep, Elephant, Bovine, Bat (97%); Pig (94%); Mouse, Hamster, Rabbit (87%); Opossum (84%); Rat (81%).
Detects a ~97kD protein, corresponding to the apparent molecular mass of STAT1alpha on SDS-PAGE immunoblots, in human, mouse, rat and bovine cell lysates and tissue extracts. This antibody does not detect the 84kD STAT1beta.
Western Blot (ECL): 0.5 ug/mL. Immunoprecipitation: 2-4 ug/sample. Positive control: HeLa Cell Lysate.

PBS, pH 7.2, 0.02% sodium azide. Supplied as an IgG fraction.
For research use only.

About STAT1

P42224 NM_007315 NP_009330.1

STAT1 Antibody, ISGF-3 Antibody, STAT91 Antibody, CANDF7 Antibody

Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2.

Requested From: 
Date Requested: 3/21/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number