  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
Research Areas
  • Cancer Research Resources and Products:
  • Breast Cancer
  • Colorectal Cancer
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-STAT1 Antibody (aa712-750) LS-C39256

Catalog Size Price
LS-C39256-100 100 µg Unavailable

Related Products

179 STAT1 Antibodies

Most Popular STAT1 Antibodies

Anti-STAT1 Antibody (phospho-Tyr701) LS-C10368
Rabbit Polyclonal (IgG) to Mouse STAT1
Western blot
Anti-STAT1 Antibody (C-Terminus) LS-C30470
Rabbit Polyclonal (IgG) to Human STAT1
Human, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep
Western blot
Recombinant STAT1 Protein Cell Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Anti-STAT1 Antibody (C-Terminus) IHC-plus™ LS-B591
Rabbit Polyclonal (IgG) to Human STAT1
Human, Mouse, Rat
IHC, IHC - Paraffin, ICC, Western blot, Immunoprecipitation
Anti-STAT1 antibody IHC of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B591 concentration 5 ug/ml.
Anti-STAT1 Antibody (clone SM1) IHC-plus™ LS-B1874
Mouse Monoclonal [clone SM1] (IgG2b) to Human STAT1
Human, Monkey, Mouse, Bat, Bovine, Dog, Hamster, Horse, Pig, Sheep
IHC, IHC - Paraffin, Western blot, Immunoprecipitation
Anti-STAT1 antibody IHC of human lung. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1874 concentration 5 ug/ml.
Anti-STAT1 Antibody (N-Terminus) IHC-plus™ LS-B4583
Rabbit Polyclonal (IgG) to Human STAT1
Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Zebrafish
IHC, IHC - Paraffin, Western blot
Anti-STAT1 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4583 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.

100% Guaranteed
Rabbit Polyclonal (IgG) to Human STAT1
Human, Dog, Horse
Western blot, Immunoprecipitation


Human STAT1
Human, Dog, Horse (tested or 100% immunogen sequence identity)
Monkey, Bat, Bovine, Pig, Sheep (at least 90% immunogen sequence identity)
IgG Polyclonal


  • Western blot
  • Immunoprecipitation

Specificity and Use

STAT1 antibody was raised against a 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the human STAT1alpha (residues 712-750) was synthesized and the peptide coupled to KLH. The sequence differs from that of mouse by four amino acids. The carboxy terminal 38. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Panda, Dog, Horse (100%); Marmoset, Sheep, Elephant, Bovine, Bat (97%); Pig (94%); Mouse, Hamster, Rabbit (87%); Opossum (84%); Rat (81%).
Detects a ~97kD protein, corresponding to the apparent molecular mass of STAT1alpha on SDS-PAGE immunoblots, in human, mouse, rat and bovine cell lysates and tissue extracts. This antibody does not detect the 84kD STAT1beta.
Western Blot (ECL): 0.5 ug/mL. Immunoprecipitation: 2-4 ug/sample. Positive control: HeLa Cell Lysate.


PBS, pH 7.2, 0.02% sodium azide. Supplied as an IgG fraction.
For research use only.

About STAT1

P42224 NM_007315 NP_009330.1

STAT1 Antibody, ISGF-3 Antibody, STAT91 Antibody, CANDF7 Antibody

Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2.

Requested From: 
Date Requested: 5/25/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number