LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-RETN / Resistin Antibody (aa33-90) LS-C131849


Wt. Vol. Conc. Price
- 20 µl - $365
- 100 µl - $695
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular RETN / Resistin Antibodies

Anti-RETN / Resistin Antibody (aa83-91) LS-C45625
Rabbit Polyclonal (IgG) to Mouse RETN / Resistin
IHC - Frozen, Western blot, ELISA
Anti-RETN / Resistin Antibody IHC-plus™ LS-B2879
Rabbit Polyclonal to Mouse RETN / Resistin
Mouse, Human
IHC - Paraffin, ICC, Western blot
Immunohistochemistry Image
Anti-RETN / Resistin Antibody IHC-plus™ LS-B7412
Mouse Monoclonal (IgG2b,k) to Human RETN / Resistin
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal to Human RETN / Resistin


Human RETN / Resistin
Human (tested or 100% immunogen sequence identity)
Monkey, Dog, Pig (at least 90% immunogen sequence identity)



Specificity and Use

RETN / Resistin antibody was raised against synthetic human Resistin (aa 33-90) bTG-conjugated(CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Cat, Dog, Pig (90%); Bovine, Horse (87%).
Recognizes human Resistin (aa 33-90).
Suitable for use in ELISA.


Lyophilized from 50 mM Tris, pH 7.2
20 µl or 100 µl Distilled water
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About RETN / Resistin

Q9HD89 NM_020415 NP_065148.1

RETN Antibody, ADSF Antibody, Fizz3 Antibody, Resistin Antibody, RETN1 Antibody, Xcp1 Antibody, RSTN Antibody, Found in inflammatory zone 3 Antibody, HXCP1 Antibody, Resistin delta2 Antibody

RETN / Resistin belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Requested From: United States
Date Requested: 1/23/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number