LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-PTH2 / Parathyroid Hormone 2 Antibody (aa62-100) LS-C132511


Wt. Vol. Conc. Price
- 20 µl - $375
- 100 µl - $680
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular PTH2 / Parathyroid Hormone 2 Antibodies

Anti-PTH2 / Parathyroid Hormone 2 Antibody (C-Terminus) LS-C82743
Rabbit Polyclonal (IgG) to Human PTH2 / Parathyroid Hormone 2
Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Western blot
Western blot Image
Anti-PTH2 / Parathyroid Hormone 2 Antibody (aa62-100) LS-C132511
Rabbit Polyclonal to Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig
ELISA, Radioimmunoassay
Anti-PTH2 / Parathyroid Hormone 2 Antibody (C-Terminus, Biotin) LS-C457187
Rabbit Polyclonal (IgG) to Human PTH2 / Parathyroid Hormone 2
Human, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig
Western blot
Biotin Conjugated
Western blot Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal to Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig
ELISA, Radioimmunoassay


Human PTH2 / Parathyroid Hormone 2
Human, Bovine, Dog, Pig (tested or 100% immunogen sequence identity)
Monkey, Mouse, Rat, Horse, Rabbit (at least 90% immunogen sequence identity)


  • ELISA (1:2000 - 1:4000)
  • Radioimmunoassay (1:2)

Specificity and Use

PTH2 / Parathyroid Hormone 2 antibody was raised against synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bovine, Pig (100%); Marmoset, Horse (97%); Elephant (94%); Mouse, Rat, Rabbit (90%).
Recognizes human TIP 39 (aa 62-100). Species cross-reactivity: bovine, canine.
Suitable for use in RIA. ELISA: 1:2000-1:4000. RIA: 1:2.000.


Lyophilized from PBS, pH 7.2
20 µl or 100 µl Sterile 40-50% glycerol.
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About PTH2 / Parathyroid Hormone 2

Q96A98 Q96A98

PTH2 Antibody, Parathyroid hormone 2 Antibody, TIPF39 Antibody, TIP39 Antibody, Tuberoinfundibular 39 residues Antibody

Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits.

Requested From: United States
Date Requested: 12/9/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number