LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-PTH / Parathyroid Hormone Antibody (aa1-38, clone A1/70) LS-C122285


Wt. Vol. Conc. Price
10 µg - - $325
100 µg - - $465
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular PTH / Parathyroid Hormone Antibodies

Anti-PTH / Parathyroid Hormone Antibody (aa1-34, clone 3H9) LS-C390883
Mouse Monoclonal [clone 3H9] (IgG2b,k) to Human PTH / Parathyroid Hormone
IHC - Paraffin, Immunofluorescence, Flow Cytometry
Immunohistochemistry Image
Anti-PTH / Parathyroid Hormone Antibody (aa1-34, clone BGN/1F8) LS-C42099
Mouse Monoclonal [clone BGN/1F8] (IgG1) to Human PTH / Parathyroid Hormone
Human, Mouse, Rat
IHC - Paraffin, IHC - Frozen, ELISA
Anti-PTH / Parathyroid Hormone Antibody (aa39-84) LS-C38074
Rabbit Polyclonal to Human PTH / Parathyroid Hormone
ICC, Western blot, ELISA

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone A1/70] (IgG1) to Human PTH / Parathyroid Hormone
Human, Monkey
IHC - Paraffin, IHC - Frozen, Radioimmunoassay


Human PTH / Parathyroid Hormone
Human, Monkey (tested or 100% immunogen sequence identity)
Bovine, Dog, Horse, Pig (at least 90% immunogen sequence identity)
IgG1 Monoclonal [A1/70]
Protein A purified


  • IHC - Paraffin
  • IHC - Frozen
  • Radioimmunoassay

Specificity and Use

PTH / Parathyroid Hormone antibody was raised against synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
Recognizes Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86).
Suitable for use in RIA. RIA: 20 ng/ml. Immunohistochemistry: Frozen, paraffin.


Lyophilized from in PBS, pH 7.2
Distilled water
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 12 months at -20°C
For research use only.

About PTH / Parathyroid Hormone

P01270 NM_000315 NP_000306.1

PTH Antibody, Parathyroid hormone Antibody, Parathyroid hormone 1 Antibody, Parathyrin Antibody, Parathormone Antibody, PTH1 Antibody

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.

Requested From: United States
Date Requested: 12/9/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number