LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-PTGER4 / EP4 Antibody IHC-plus™ LS-B6947

Note: This antibody replaces LS-C146661


Wt. Vol. Conc. Price
- 1 ea - $395
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular PTGER4 / EP4 Antibodies

Anti-PTGER4 / EP4 Antibody (C-Terminus) IHC-plus™ LS-A3890
Rabbit Polyclonal to Human PTGER4 / EP4
Human, Monkey, Bovine
IHC - Paraffin
Immunohistochemistry Image
Anti-PTGER4 / EP4 Antibody (N-Terminus) IHC-plus™ LS-A3898
Rabbit Polyclonal to Human PTGER4 / EP4
IHC - Paraffin, ICC
Immunohistochemistry Image
Anti-PTGER4 / EP4 Antibody IHC-plus™ LS-B6947
Rabbit Polyclonal (IgG) to Human PTGER4 / EP4
IHC - Paraffin, ICC, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human PTGER4 / EP4
IHC - Paraffin, ICC, Western blot


Human PTGER4 / EP4
Human (tested or 100% immunogen sequence identity)
Monkey, Bovine, Rabbit (at least 90% immunogen sequence identity)
IgG Polyclonal
Affinity purified


  • IHC - Paraffin (1:100)
  • ICC
  • Western blot (1:200)

Specificity and Use

PTGER4 / EP4 antibody was raised against human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Gibbon, Bovine (97%); Rabbit (93%); Marmoset (90%); Bat, Hamster, Elephant, Panda (87%); Horse (83%); Mouse, Rat (80%).
Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.


TBS, pH 7.4, 0.1% BSA, 0.02% sodium azide, 50% glycerol.
Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
For research use only.

About PTGER4 / EP4

P35408 NM_000958 NP_000949.1

PTGER4 Antibody, EP4 Antibody, EP4 prostaglandin receptor Antibody, EP4R Antibody, PGE receptor EP4 subtype Antibody, Prostanoid EP4 receptor Antibody, Prostaglandin E receptor 4 Antibody, PGE receptor, EP4 subtype Antibody, PGE2 receptor EP4 subtype Antibody

PTGER4 / EP4 is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3.


Anti-PTGER4 / EP4 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6947 concentration 5 ug/ml.

Western blot

Western blot
Western blot of PTGER4 / EP4 antibody LS-B6947.

Requested From: United States
Date Requested: 1/17/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number