LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus™ LS-B1615

Note: This antibody replaces LS-C11684

Wt. Vol. Conc. Price
- 1 ea - $395
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular PGIS / PTGIS Antibodies

Anti-PGIS / PTGIS Antibody (clone isn-1) LS-C11192
Mouse Monoclonal [clone isn-1] (IgG1) to Bovine PGIS / PTGIS
Bovine, Mouse, Rat, Guinea pig, Rabbit, Sheep
IHC, Immunoprecipitation
Anti-PGIS / PTGIS Antibody (aa475-490) IHC-plus™ LS-B1505
Rabbit Polyclonal (IgG) to Mouse PGIS / PTGIS
Mouse, Human, Monkey, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-PGIS / PTGIS Antibody (aa472-500) LS-C167246
Rabbit Polyclonal to Human PGIS / PTGIS
IHC - Paraffin, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Bovine PGIS / PTGIS
Bovine, Human
IHC - Paraffin, Western blot, Immunoprecipitation

Bovine, Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified

  • IHC - Paraffin (5 µg/ml)
  • Western blot
  • Immunoprecipitation

Specificity and Use

PGIS / PTGIS antibody was raised against bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%).
Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
Immunohistochemistry: LS-B1615 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for LS-B1615 was determined to be 5 ug/ml.

TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

Q16647 NM_000961 NP_000952.1

PTGIS Antibody, CYP8A1 Antibody, Prostaglandin I2 synthase Antibody, Prostacyclin synthase Antibody, PTGI Antibody, CYP8 Antibody, PGIS Antibody

PGIS / PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Anti-PTGIS antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1615 concentration 5 ug/ml.

Requested From: United States
Date Requested: 10/25/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number