Human MICA

Rabbit

Human (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunogen affinity purified

Unmodified

A synthetic peptide corresponding to a sequence at the C-Terminus of human MICA (304-334 aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).

aa304-334

Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells. .

• Western blot (0.1 - 0.5 µg/ml)

Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: Q29983 NCBI: NM_000247 NP_000238.1