  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-MAPK3 / ERK1 Antibody (aa336-367) LS-C16357

Catalog Size Price
LS-C16357-50 50 µg (1 mg/ml) Unavailable
LS-C16357-200 200 µg Unavailable

Related Products

219 MAPK3 / ERK1 Antibodies

Most Popular MAPK3 / ERK1 Antibodies

Anti-MAPK3 / ERK1 Antibody (Internal) IHC-plus™ LS-A2877
Rabbit Polyclonal to Human MAPK3 / ERK1
Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig
IHC - Paraffin
Immunohistochemistry Image
Anti-MAPK3 / ERK1 Antibody (Internal) IHC-plus™ LS-A3520
Rabbit Polyclonal to Human MAPK3 / ERK1
Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig
IHC - Paraffin
Immunohistochemistry Image
Anti-MAPK3 / ERK1 Antibody (phospho-Thr202/Tyr204) LS-C16352
Rabbit Polyclonal (IgG) to Human MAPK3 / ERK1
Human, Mouse, Rat, Hamster, Chicken
ICC, Immunofluorescence, Western blot, Immunoprecipitation, Flow Cytometry, ELISA
Anti-MAPK3 / ERK1 Antibody (aa324-345) LS-C16359
Mouse Monoclonal (IgG1,k) to Rat MAPK3 / ERK1
Rat, Human, Mouse, Dog
Western blot, Immunoprecipitation, ELISA
Anti-MAPK3 / ERK1 Antibody (Internal) IHC-plus™ LS-A2878
Rabbit Polyclonal to Human MAPK3 / ERK1
Human, Monkey
IHC - Paraffin
Immunohistochemistry Image

100% Guaranteed
Rabbit Polyclonal to Rat MAPK3 / ERK1
Rat, Mouse, Hamster, Rabbit
IHC, Western blot, Immunoprecipitation


Rat MAPK3 / ERK1
Rat, Mouse, Hamster, Rabbit (tested or 100% immunogen sequence identity)
Human, Monkey, Bat, Bovine, Dog, Horse (at least 90% immunogen sequence identity)
Protein A purified


  • IHC (10 µg/ml)
  • Western blot
  • Immunoprecipitation (12.5 µg/ml)

Specificity and Use

MAPK3 / ERK1 antibody was raised against a 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
Western Blot (Colorimetric): 1 ug/ml 1 ug/ml. Western Blot (ECL). Immunoprecipitation: 12.5 ug/ml. Immunohistochemistry: 10 ug/ml. Positive control: Mouse Brain Tissue Extract.


Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About MAPK3 / ERK1

P27361 X60188 CAA42744.1

MAPK3 Antibody, ERK-1 Antibody, ERT2 Antibody, HUMKER1A Antibody, HS44KDAP Antibody, MAP kinase 1 Antibody, MAP kinase isoform p44 Antibody, MAPK 1 Antibody, MAPK 3 Antibody, p44 Antibody, p44MAPK Antibody, p44-MAPK Antibody, p44ERK1 Antibody, Insulin-stimulated MAP2 kinase Antibody, MAP kinase 3 Antibody, p44-ERK1 Antibody, ERK1 Antibody, PRKM3 Antibody

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF.

Requested From: 
Date Requested: 6/25/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number