LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-LYZL6 Antibody LS-C122076


Wt. Vol. Conc. Price
- 100 µl - $710
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular LYZL6 Antibodies

Anti-LYZL6 Antibody LS-C122076
Rabbit Polyclonal (IgG) to Human LYZL6
IHC - Paraffin
Anti-LYZL6 Antibody (aa37-65, APC) LS-C262407
Rabbit Polyclonal (IgG) to Human LYZL6
Western blot, ELISA
APC Conjugated

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human LYZL6
IHC - Paraffin


Human LYZL6
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified


IHC - Paraffin

Specificity and Use

LYZL6 antibody was raised against lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP. Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon (97%); Monkey, Marmoset (90%).
Recognizes human Lysozyme-like 6.
Suitable for use in Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferous ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.


PBS, pH 7.2, 40% glycerol, 0.02% sodium azide
May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 12 months at -20°C
For research use only.

About LYZL6

O75951 NM_020426 NP_065159.1

LYZL6 Antibody, LYC1 Antibody, Lysozyme homolog Antibody, PRO1485 Antibody, Lysozyme-like 6 Antibody, Lysozyme-like protein 6 Antibody, TKAL754 Antibody, UNQ754 Antibody

LYZL6 encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene.

Requested From: United States
Date Requested: 1/18/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number