LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
JUP/CTNNG/Junction Plakoglobin Antibody LS‑C331167
Junction Plakoglobin antibody LS-C331167 is an unconjugated rabbit polyclonal antibody to Junction Plakoglobin (JUP / CTNNG) from human, mouse and rat. Validated for IF, IHC, IP and WB.
Catalog
Size
Price
LS-C331167-50
50 µl
$235
LS-C331167-100
100 µl
$315
LS-C331167-200
200 µl
$425

Popular JUP/CTNNG/Junction Plakoglobin Products

Anti-Gamma Catenin antibody IHC of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4364 concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Anti-Gamma Catenin antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2204 concentration 5 ug/ml.
Species: Human, Monkey, Mouse, Dog, Hamster, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Antibody
Species: Human
Applications: Immunofluorescence, Western blot, Immunoprecipitation
Antibody
Species: Bovine, Human, Mouse, Rat, Chicken
Applications: IHC, ICC, Western blot, Immunoprecipitation
Antibody
Species: Human
Applications: Western blot, ELISA

Product Description

JUP/CTNNG/Junction Plakoglobin Antibody for IHC, IF/Immunofluorescence, WB/Western, IP LS-C331167

Specifications

Target
Human JUP/CTNNG/Junction Plakoglobin
Synonyms
JUP, Desmoplakin-3, CTNNG, DPIII, Gamma catenin, Junction plakoglobin, PKGB, ARVD12, Catenin gamma, Desmoplakin III, DP3, PDGB
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human JUP (NP_002221.1). MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
Specificity
Human JUP/CTNNG/Junction Plakoglobin.
Usage
The predicted MW is 81kDa, while the observed MW by Western blot was 82kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About JUP/CTNNG/Junction Plakoglobin
Common junctional plaque protein. The membrane-associated plaques are architectural elements in an important strategic position to influence the arrangement and function of both the cytoskeleton and the cells within the tissue. The presence of plakoglobin in both the desmosomes and in the intermediate junctions suggests that it plays a central role in the structure and function of submembranous plaques. P14923 NM_002230 NP_002221.1


Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Immunofluorescence

Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using JUP antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using JUP antibody at 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of MCF-7 cells, using 3 ug JUP antibody (A0963). Western blot was performed from the immunoprecipitate using JUP antibody (A0963) at a dilition of 1:1000.

Requested From: United States
Date Requested: 10/22/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy