Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IVL / Involucrin Antibody LS‑C490386
Involucrin antibody LS-C490386 is an unconjugated rabbit polyclonal antibody to human Involucrin (IVL). Validated for WB.
100 µg

Popular IVL / Involucrin Products

Anti-IVL / Involucrin antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B3058 concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Anti-IVL / Involucrin antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6298 concentration 10 ug/ml.
Species: Human, Monkey, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA
Species: Human, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, ICC, Western blot
Western blot of recombinant IVL / Involucrin.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: IHC, Western blot
Species: Human, Gorilla, Dog, Pig, Owl monkey
Applications: IHC, IHC - Paraffin, Immunofluorescence, Flow Cytometry

Product Description

Involucrin antibody LS-C490386 is an unconjugated rabbit polyclonal antibody to human Involucrin (IVL). Validated for WB.
About IVL / Involucrin
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. P07476 NM_005547 NP_005538.2

IVL Antibody, Involucrin Antibody


Human IVL / Involucrin
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)


Western blot

Western blot

Western blot

Western blot

Requested From: 
Date Requested: 7/17/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number