LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IVL / Involucrin Antibody LS‑C409568
Involucrin antibody LS-C409568 is an unconjugated rabbit polyclonal antibody to Involucrin (IVL) from human and mouse. Validated for WB.
Catalog
Size
Price
LS-C409568-50
50 µl
$235
LS-C409568-100
100 µl
$295
LS-C409568-200
200 µl
$385

Popular IVL / Involucrin Products

Anti-IVL / Involucrin antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B3058 concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Anti-IVL / Involucrin antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6298 concentration 10 ug/ml.
Species: Human, Monkey, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA
Antibody
Species: Human, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, ICC, Western blot
Western blot of recombinant IVL / Involucrin.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: IHC, Western blot
Antibody
Species: Human, Gorilla, Dog, Pig, Owl monkey
Applications: IHC, IHC - Paraffin, Immunofluorescence, Flow Cytometry

Product Description

Involucrin antibody LS-C409568 is an unconjugated rabbit polyclonal antibody to Involucrin (IVL) from human and mouse. Validated for WB.
About IVL / Involucrin
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. P07476 NM_005547 NP_005538.2

IVL Antibody, Involucrin Antibody


Specifications

Target
Human IVL / Involucrin
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2). QERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK
Specificity
Human IVL / Involucrin
Usage
The predicted MW is 68kDa, while the observed MW by Western blot was 80kDa.
Presentation
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 7/22/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number