LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
IVL / Involucrin Antibody (aa551‑585) LS‑C407924
Involucrin antibody LS-C407924 is an unconjugated rabbit polyclonal antibody to human Involucrin (IVL). Validated for WB.
Catalog
Size
Price
LS-C407924-100
100 µg
$325

Popular IVL / Involucrin Products

Anti-IVL / Involucrin antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6298 concentration 10 ug/ml.
Species: Human, Monkey, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA
Western blot of recombinant IVL / Involucrin.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: IHC, Western blot
Anti-IVL / Involucrin antibody IHC of human lung. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B3058 concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human, Dog, Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, ICC, Western blot
Antibody
Species: Human, Gorilla, Dog, Pig, Owl monkey
Applications: IHC, IHC - Paraffin, Immunofluorescence, Flow Cytometry

Product Description

IVL / Involucrin Antibody (aa551-585) for WB/Western LS-C407924

Specifications

Target
Human IVL / Involucrin
Synonyms
IVL, Involucrin
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Epitope
aa551-585
Specificity
Keratinocytes of epidermis and other stratified squamous epithelia.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About IVL / Involucrin
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. P07476 NM_005547 NP_005538.2


Publications (0)


Customer Reviews (0)


Images

Western blot

Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.

Western blot

Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.

Western blot

Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.

Western blot

Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.

Requested From: United States
Date Requested: 10/20/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy