  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-IVL / Involucrin Antibody (aa551-585) LS-C407924

Catalog Size Price
LS-C407924-100 100 µg Unavailable

Most Popular IVL / Involucrin Antibodies

Anti-IVL / Involucrin Antibody (aa420-578) IHC-plus™ LS-B3058
Rabbit Polyclonal to Human IVL / Involucrin
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-IVL / Involucrin Antibody (clone SY5) IHC-plus™ LS-B6298
Mouse Monoclonal [clone SY5] (IgG1) to Human IVL / Involucrin
Human, Monkey, Dog, Pig
IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA
Immunohistochemistry Image
Anti-IVL / Involucrin Antibody (clone IL-9) LS-C171169
Mouse Monoclonal [clone IL-9] (IgG1) to Human IVL / Involucrin
Human, Dog, Pig
IHC - Paraffin, IHC - Frozen, ICC, Western blot
Anti-IVL / Involucrin Antibody (aa301-460) LS-C294948
Rabbit Polyclonal (IgG) to Mouse IVL / Involucrin
Western blot
Western blot Image
Anti-IVL / Involucrin Antibody (clone SY5) LS-C357940
Mouse Monoclonal [clone SY5] (IgG1,k) to Human IVL / Involucrin
Human, Gorilla, Dog, Pig, Owl monkey
IHC - Paraffin, Immunofluorescence, Flow Cytometry

100% Guaranteed
Rabbit Polyclonal to Human IVL / Involucrin
Western blot


Human IVL / Involucrin
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified


Western blot (0.1 - 0.5 µg/ml)

Specificity and Use

A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Keratinocytes of epidermis and other stratified squamous epithelia.


Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
For research use only.

About IVL / Involucrin

P07476 NM_005547 NP_005538.2

IVL Antibody, Involucrin Antibody

Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.

Western blot

Western blot
Involucrin antibody Western blot. All lanes: Anti Involucrin at 0.5 ug/ml. Lane 1: A431 Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.

Requested From: 
Date Requested: 1/19/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number