  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-ITGA3 / CD49c Antibody (Cytoplasmic Domain, clone 54B3) LS-C24753

Catalog Size Price
LS-C24753-100 100 µg Unavailable

Related Products

80 ITGA3 / CD49c Antibodies

Most Popular ITGA3 / CD49c Antibodies

Anti-ITGA3 / CD49c Antibody (aa1040-1051) LS-C15959
Rabbit Polyclonal (IgG) to Human ITGA3 / CD49c
IHC - Frozen, Immunofluorescence, Western blot, Immunoprecipitation, ELISA, Radioimmunoassay
Anti-ITGA3 / CD49c Antibody LS-C15960
Mouse Monoclonal (IgG1) to Human ITGA3 / CD49c
ICC, Immunoprecipitation, Flow Cytometry, ELISA, Radioimmunoassay
Anti-ITGA3 / CD49c Antibody (N-Terminus) IHC-plus™ LS-A8136
Rabbit Polyclonal to Human ITGA3 / CD49c
Human, Bovine
IHC - Paraffin
Immunohistochemistry Image
Anti-ITGA3 / CD49c Antibody (Internal) IHC-plus™ LS-A8140
Rabbit Polyclonal to Human ITGA3 / CD49c
Human, Monkey
IHC - Paraffin
Immunohistochemistry Image
Anti-ITGA3 / CD49c Antibody (aa33-993, PE) LS-C125769
Goat Polyclonal (IgG) to Mouse ITGA3 / CD49c
Flow Cytometry
PE Conjugated

100% Guaranteed
Mouse Monoclonal [clone 54B3] (IgG1) to Human ITGA3 / CD49c
IHC - Frozen, ICC, Western blot


Human ITGA3 / CD49c
Human (tested or 100% immunogen sequence identity)
IgG1 Monoclonal [54B3]
Protein G purified


  • IHC - Frozen
  • ICC
  • Western blot

Specificity and Use

ITGA3 / CD49c antibody was raised against synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin a3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH.
Cytoplasmic Domain
Recognizes specifically the cytoplasmic domain of human integrin subunit a3B which is present in microvascular structures in brain and heart. Broad species crossreactivity is expected because of the conserved nature of the epitope.
Immunohistochemistry (frozen): 1:25 - 1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1,000. Optimum dilutions to be determined by researcher.


PBS, pH 7.2, 0.1% sodium azide. No stabilizing proteins added.
Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

About ITGA3 / CD49c

P26006 NM_002204 NP_002195.1

ITGA3 Antibody, Alpha3 integrin Antibody, CD49c antigen Antibody, CD49C Antibody, GAPB3 Antibody, Integrin alpha-3 Antibody, FRP-2 Antibody, VCA-2 Antibody, VLA-3 subunit alpha Antibody, VL3A Antibody, VLA3a Antibody, Galactoprotein B3 Antibody, GAP-B3 Antibody, ILNEB Antibody, Integrin alpha3 Antibody, MSK18 Antibody

ITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.

Requested From: 
Date Requested: 12/16/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number