LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
ITGA3 / CD49c Antibody (clone 29A3) LS‑C146754
Note: This antibody replaces LS-C147840
CD49c antibody LS-C146754 is an unconjugated mouse monoclonal antibody to human CD49c (ITGA3). Validated for ICC, IHC and WB.
Catalog
Size
Price
LS-C146754-100
100 µg
Unavailable

Popular ITGA3 / CD49c Products

Antibody
Species: Human
Applications: IHC, IHC - Frozen, Immunofluorescence, Western blot, Immunoprecipitation, ELISA, Radioimmunoassay
Antibody
Species: Human
Applications: ICC, Immunoprecipitation, Flow Cytometry, ELISA, Radioimmunoassay
Anti-ITGA3 / CD49c antibody LS-A8136 IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Bovine
Applications: IHC, IHC - Paraffin
Anti-ITGA3 / CD49c antibody LS-A8140 IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin
Antibody
Species: Mouse
Applications: Flow Cytometry

Product Description

CD49c antibody LS-C146754 is an unconjugated mouse monoclonal antibody to human CD49c (ITGA3). Validated for ICC, IHC and WB.
About ITGA3 / CD49c
ITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. P26006 NM_002204 NP_002195.1

ITGA3 Antibody, Alpha3 integrin Antibody, CD49c antigen Antibody, CD49C Antibody, GAPB3 Antibody, Integrin alpha-3 Antibody, FRP-2 Antibody, VCA-2 Antibody, VLA-3 subunit alpha Antibody, VL3A Antibody, VLA3a Antibody, Galactoprotein B3 Antibody, GAP-B3 Antibody, ILNEB Antibody, Integrin alpha3 Antibody, MSK18 Antibody


Specifications

Target
Human ITGA3 / CD49c
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal [29A3]
Conjugations
Unconjugated
Purification
Purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Frozen (1:100 - 1:200)
  • ICC
  • Western blot (1:100 - 1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Failed Applications
  • IHC - Paraffin
Immunogen
ITGA3 / CD49c antibody was raised against synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Specificity
Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
Presentation
PBS containing 0.09% sodium azide
Storage
Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images


Immunohistochemistry

Immunohistochemistry on frozen section of human kidney
Immunohistochemistry on frozen section of human kidney

Immunohistochemistry

Immunohistochemistry on frozen section of human kidney
Immunohistochemistry on frozen section of human kidney

Immunohistochemistry

Immunohistochemistry on frozen section of human kidney
Immunohistochemistry on frozen section of human kidney

Immunohistochemistry

Immunohistochemistry on frozen section of human kidney
Immunohistochemistry on frozen section of human kidney


Requested From: 
Date Requested: 6/23/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number