LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-IL-22BP / IL22RA2 Antibody (aa33-60) LS-C83979

Note: This antibody replaces LS-C8227, LS-C71014


Wt. Vol. Conc. Price
200 µg - 1 mg/ml $455
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular IL-22BP / IL22RA2 Antibodies

Anti-IL-22BP / IL22RA2 Antibody (aa1-218) LS-C185538
Rabbit Polyclonal (IgG) to Human IL-22BP / IL22RA2
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-IL-22BP / IL22RA2 Antibody (aa15-42, Biotin) LS-C236572
Rabbit Polyclonal (IgG) to Human IL-22BP / IL22RA2
Western blot, ELISA
Biotin Conjugated
Anti-IL-22BP / IL22RA2 Antibody (aa14-42) LS-C322216
Rabbit Polyclonal (IgG) to Human IL-22BP / IL22RA2
Western blot, ELISA

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Human IL-22BP / IL22RA2
Human, Monkey


Human IL-22BP / IL22RA2
Human, Monkey (tested or 100% immunogen sequence identity)
Immunoaffinity purified


ELISA (1:50000)
IHC - Paraffin

Specificity and Use

IL-22BP / IL22RA2 antibody was raised against synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).
This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.
ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.


10mM KHPO4, 140mM NaCl, BSA, 0.1% sodium azide
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
For research use only.

About IL-22BP / IL22RA2

Q969J5 NM_052962 NP_443194.1

IL22RA2 Antibody, Class II cytokine receptor Antibody, IL-22BP Antibody, IL-22RA2 Antibody, IL-22R-alpha-2 Antibody, Interleukin 22-binding protein Antibody, Interleukin-22-binding protein Antibody, CRF2-10 Antibody, CRF2-S1 Antibody, CRF2X Antibody, IL-22 receptor subunit alpha-2 Antibody, IL22BP Antibody, ZcytoR16 Antibody

Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.Isoform 1 may play a role in establishing and maintaining successful pregnancy.

Requested From: United States
Date Requested: 2/20/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number