Human IL-22BP / IL22RA2

Goat

Human, Monkey (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunoaffinity purified

Unmodified

Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-Terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).

aa33-60

This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.

• ELISA (1:50000)

• IHC - Paraffin

ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.

10mM KHPO4, 140mM NaCl, 1mg/ml BSA, 0.1% sodium azide

Store at -20°C. Aliquot to avoid freeze/thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: Q969J5 NCBI: NM_052962 NP_443194.1