LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-IAPP / Amylin Antibody LS-C190476


Wt. Vol. Conc. Price
- 50 µl - $445
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular IAPP / Amylin Antibodies

Anti-IAPP / Amylin Antibody LS-C20520
Rabbit Polyclonal (IgG) to Human IAPP / Amylin
Western blot, ELISA
Anti-IAPP / Amylin Antibody (clone R10/99) IHC-plus™ LS-B35
Mouse Monoclonal [clone R10/99] (IgG1) to Human IAPP / Amylin
IHC - Paraffin, IHC - Frozen, Immunofluorescence
Immunohistochemistry Image
Anti-IAPP / Amylin Antibody (N-Terminus) IHC-plus™ LS-B2785
Rabbit Polyclonal to Human IAPP / Amylin
IHC - Paraffin
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human IAPP / Amylin
IHC - Paraffin


Human IAPP / Amylin
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal


IHC - Paraffin

Specificity and Use

IAPP / Amylin antibody was raised against synthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Human Amylin.
Immunohistochemistry (formalin-fixed paraffin): 1:200 (ABC, DAB). Boil tissue sections in 10 mM citrate buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min.


50 µl Sterile distilled water
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About IAPP / Amylin

P10997 NM_000415 NP_000406.1

IAPP Antibody, Diabetes-associated peptide Antibody, Islet amyloid polypeptide Antibody, AMYLIN Antibody, IAP Antibody, Insulinoma amyloid peptide Antibody

IAPP / Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. Studies suggest that this protein, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. This protein also exhibits an bactericidal, antimicrobial activity.

Requested From: United States
Date Requested: 2/19/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number