Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > HSP90AB1 / HSP90 Alpha B1 > LS-C407848
 
Print Page  
Catalog Number Size Price
LS-C407848-10 10 µg $318 
LS-C407848-100 100 µg $470 
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Human Placenta Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody Western blot. All lanes: Anti Hsp90 beta at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Human Placenta Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody Western blot. All lanes: Anti Hsp90 beta at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
1 of 9
2 of 9
3 of 9
4 of 9
5 of 9
6 of 9
7 of 9
8 of 9
9 of 9

Polyclonal Rabbit anti‑Human HSP90AB1 / HSP90 Alpha B1 Antibody (aa449‑481, IHC, WB) LS‑C407848

Polyclonal Rabbit anti‑Human HSP90AB1 / HSP90 Alpha B1 Antibody (aa449‑481, IHC, WB) LS‑C407848

Submit Review LSBio Guarantee
Antibody:
HSP90AB1 / HSP90 Alpha B1 Rabbit anti-Human Polyclonal (aa449-481) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407848-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
HSP90AB1 / HSP90 Alpha B1 Rabbit anti-Human Polyclonal (aa449-481) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep
Format:
Unconjugated, Unmodified

Specifications

Description
HSP90 Alpha B1 antibody LS-C407848 is an unconjugated rabbit polyclonal antibody to HSP90 Alpha B1 (HSP90AB1) (aa449-481) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human HSP90AB1 / HSP90 Alpha B1
Synonyms
HSP90AB1 | D6S182 | Heat shock 84 kDa | Heat shock protein beta | Heat shock protein HSP 90-beta | HSP 84 | HSP84 | HSP 90 | HSP90-BETA | HSP90B | HSPC2 | HSPCB
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp90 beta (449-481 aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
Epitope
aa449-481
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSP90AB1 / HSP90 Alpha B1
P08238 NM_007355 NP_031381.2

Publications (0)

Submit a Publication for LS-C407848

Customer Reviews (0)

Submit a review for LS-C407848

Featured Products

Product
HSP90AB1 / HSP90 Alpha B1 Antibody LS‑C36626
Species: Human
Applications: Western blot, ELISA
HSP90AB1 / HSP90 Alpha B1 Antibody - Formalin-fixed and paraffin-embedded human testis tissue reacted with HSP90AB1 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
HSP90AB1 / HSP90 Alpha B1 Antibody (aa697‑724) LS‑C165051
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
HSP90AB1 / HSP90 Alpha B1 Antibody - Anti-HSP90B1 / GP96 / GRP94 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:100.
IHC‑plus™ HSP90AB1 / HSP90 Alpha B1 Antibody (aa211‑260) LS‑B10956
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
HSP90AB1 / HSP90 Alpha B1 Antibody - Anti-HSP90AB1 / HSP90 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:50.
IHC‑plus™ HSP90AB1 / HSP90 Alpha B1 Antibody (aa149‑357, clone 5G4) LS‑B10733
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry, ELISA
HSP90AB1 / HSP90 Alpha B1 Antibody - Immunohistochemical analysis of HSP90 beta (pS226) staining in human lung cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
HSP90AB1 / HSP90 Alpha B1 Antibody (phospho‑Ser226) LS‑C359019
Species: Human, Monkey, Mouse, Rat, Bovine
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
HSP90AB1 / HSP90 Alpha B1 ELISA Kit
Human HSP90AB1 / HSP90 Alpha B1 (Sandwich ELISA) ELISA Kit - LS-F9053
Reactivity: Human
Range: 1.56-100 ng/ml
See all HSP90AB1 / HSP90 Alpha B1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/15/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com