LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody (aa454-524) LS-C67312


Wt. Vol. Conc. Price
50 µg - - Unavailable

Most Popular HSP90AA1 / Hsp90 Alpha A1 Antibodies

Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody LS-C15727
Rabbit Polyclonal (IgG) to Human HSP90AA1 / Hsp90 Alpha A1
Human, Mouse, Rat, Bovine
Western blot
Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody LS-C24176
Rat Monoclonal (IgG2a) to Human HSP90AA1 / Hsp90 Alpha A1
Human, Chicken
IHC, Western blot, Flow Cytometry
Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody (aa289-300) IHC-plus™ LS-B375
Rabbit Polyclonal to Human HSP90AA1 / Hsp90 Alpha A1
Human, Monkey, Mouse, Rat, Chicken, Drosophila
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image
Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody (aa1-732) LS-C36617
Mouse Monoclonal (IgG2b,k) to Human HSP90AA1 / Hsp90 Alpha A1
Western blot, ELISA
Anti-HSP90AA1 / Hsp90 Alpha A1 Antibody LS-C67306
Mouse Monoclonal (IgG1)
Human, Mouse, Rat, Guinea pig, Rabbit, Sheep
IHC - Frozen, Western blot, Immunoprecipitation

100% Guaranteed 100% Guaranteed
Chicken Polyclonal (IgY) to Human HSP90AA1 / Hsp90 Alpha A1
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Chicken
Western blot


Human HSP90AA1 / Hsp90 Alpha A1
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity)
Xenopus, Zebrafish (at least 90% immunogen sequence identity)
IgY Polyclonal
Immunoaffinity purified


Western blot

Specificity and Use

HSP90AA1 / Hsp90 Alpha A1 antibody was raised against synthetic peptide: NRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPI, corresponding to amino acids 454-524 of Human Hsp90. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken (100%); Xenopus, Pufferfish, Zebrafish (97%); Platypus (94%); Gorilla, Salmon, Stickleback, Ant (87%); Blood fluke (81%).
Species cross-reactivity: Cross-reacts with Human, Mouse and Rat. Not yet tested in other species.
Suitable for use in Western Blot.


PBS, pH 7.2. No preservative added.
For research use only.

About HSP90AA1 / Hsp90 Alpha A1

P07900 NM_005348 NP_005339.3

HSP90AA1 Antibody, EL52 Antibody, HSP86 Antibody, Hsp89 Antibody, HSP89A Antibody, HSPC1 Antibody, Heat shock 86 kDa Antibody, Hsp90 Antibody, HSP90A Antibody, HSP90N Antibody, HSPCA Antibody, HSPCAL4 Antibody, HSPN Antibody, LAP2 Antibody, HSP 86 Antibody, HSPCAL1 Antibody

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Requested From: 
Date Requested: 4/27/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number