LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-HDAC4 Antibody (N-Terminus) LS-C109881


Wt. Vol. Conc. Price
50 µg - - Unavailable

Most Popular HDAC4 Antibodies

Anti-HDAC4 Antibody (Ser632) IHC-plus™ LS-B1476
Rabbit Polyclonal (IgG) to Human HDAC4
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot
Immunohistochemistry Image
Anti-HDAC4 Antibody (N-Terminus) IHC-plus™ LS-B1999
Rabbit Polyclonal (IgG) to Mouse HDAC4
Mouse, Human
IHC - Paraffin, Immunofluorescence, Western blot
Immunohistochemistry Image
Anti-HDAC4 Antibody (aa194-209) IHC-plus™ LS-B2033
Rabbit Polyclonal (IgG) to Human HDAC4
Human, Mouse
IHC - Paraffin, Western blot, Immunoprecipitation, Chromatin Immunoprecipitation
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal to Human HDAC4
Western blot (applications tested for the base form of this product only)


Human HDAC4
Unconjugated. Also available conjugated with Biotin, FITC, HRP.
Immunoaffinity purified


  • Western blot (1 µg/ml)
  • (applications tested for the base form of this product only)

  • IHC - Paraffin

Specificity and Use

HDAC4 antibody was raised against a synthetic peptide containing 14-22 aa derived from: EKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNH.
Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody.


Lyophilized from PBS with 2% sucrose
Distilled water
Long term: -20°C, the use of 50% glycerol is recommended if storing aliquots in -20°C for long term use (up to 1 year); Short term (less than one week): +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About HDAC4

P56524 NM_006037 NP_006028.2

HDAC4 Antibody, BDMR Antibody, AHO3 Antibody, Histone deacetylase A Antibody, HD4 Antibody, HA6116 Antibody, HDAC-A Antibody, HDACA Antibody, Histone deacetylase 4 Antibody, HDAC-4 Antibody, KIAA0288 Antibody

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.

Western blot

Western blot
HDAC4 antibody Western Blot of HeLa cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.

Requested From: 
Date Requested: 3/24/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number