LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
GLP2 Antibody (C‑Terminus) LS‑C23840
GLP2 antibody LS-C23840 is an unconjugated rabbit polyclonal antibody to human GLP2. Validated for ELISA and WB.
Antibody
Catalog
Size
Price
LS-C23840-50
50 µg (1 mg/ml)
$445
LS-C23840-100
100 µg (1 mg/ml)
$755

Popular GLP2 Products

Antibody
Species: Human
Applications: ELISA
Antibody
Species: Human, Rat
Applications: ELISA
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Western blot, Immunoprecipitation
Antibody
Species: Human
Applications: Western blot, ELISA

Product Description

GLP2 antibody LS-C23840 is an unconjugated rabbit polyclonal antibody to human GLP2. Validated for ELISA and WB.
About GLP2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

Specifications

Target
Human GLP2
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • Western blot (1 - 10 µg/ml)
  • ELISA (1:10000 - 1:100000)
Immunogen
GLP2 antibody was raised against synthetic peptide corresponding to an 8aa C- terminal epitope of human GLP2.
Epitope
C-Terminus
Specificity
Recognizes human GLP2.
Usage
Suitable for use in ELISA and Western Blot. Western Blot: 1-10 ug/ml using Chemiluminescence. ELISA: 1:10000-1:100000; using 50-100 ng control peptide/well.
Presentation
PBS, pH 7.5, 0.1% BSA.
Storage
Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 9/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy