LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-GLP1 / Glucagon-Like Peptide 1 Antibody (clone 13A111, Biotin) LS-C183014


Wt. Vol. Conc. Price
- 50 µl 1 mg/ml Unavailable

Most Popular GLP1 / Glucagon-Like Peptide 1 Antibodies

Anti-GLP1 / Glucagon-Like Peptide 1 Antibody (clone 4F3) LS-C23833
Mouse Monoclonal [clone 4F3] (IgG1,k) to Human GLP1 / Glucagon-Like Peptide 1
Western blot, ELISA
Anti-GLP1 / Glucagon-Like Peptide 1 Antibody (aa7-36) LS-C23835
Mouse Monoclonal (IgG1) to Human GLP1 / Glucagon-Like Peptide 1
IHC - Paraffin, ICC, Dot Blot
Anti-GLP1 / Glucagon-Like Peptide 1 Antibody (C-Terminus, Biotin) LS-C23839
Rabbit Polyclonal (IgG) to Human GLP1 / Glucagon-Like Peptide 1
Western blot, ELISA
Biotin Conjugated

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone 13A111] (IgG2a,k) to Rat GLP1 / Glucagon-Like Peptide 1
Biotin Conjugated


Rat GLP1 / Glucagon-Like Peptide 1
Rat (tested or 100% immunogen sequence identity)
Human, Monkey, Mouse, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep (at least 90% immunogen sequence identity)
IgG2a,k Monoclonal [13A111]



Specificity and Use

Synthetic GLP-1(7-36)amide (HAEGTFTSNVSSYLEGQAAKEFIAWLVKGR) coupled to carrier and adsorbed onto aluminum hydroxide gel.
Rat GLP-1. Species Crossreactivity: GLP-1(9-37) /GLP-1(9-36amide).
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.


10 mM phosphate buffer, pH 7.4, 0.14 M sodium chloride, 15 mM sodium azide
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months.
For research use only.

About GLP1 / Glucagon-Like Peptide 1

Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. The biologically active forms of GLP-1 are: GLP-1-(7-37) and GLP-1-(7-36)NH2. Those peptides result from selective cleavage of the proglucagon molecule.

Requested From: 
Date Requested: 3/26/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number