LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-GDF9 / GDF-9 Antibody (aa420-451, clone mAb-GDF9-53) LS-C188621


Wt. Vol. Conc. Price
100 µg - 1 mg/ml $915
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular GDF9 / GDF-9 Antibodies

Anti-GDF9 / GDF-9 Antibody (aa45-59) IHC-plus™ LS-B809
Rabbit Polyclonal to Human GDF9 / GDF-9
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image
Anti-GDF9 / GDF-9 Antibody (aa420-451, clone mAb-GDF9-53) LS-C188621
Mouse Monoclonal [clone mAb-GDF9-53] (IgG) to Human GDF9 / GDF-9
Human, Monkey, Bat, Dog
IHC - Paraffin, IHC - Frozen, Western blot, Functional Assay
Western blot Image
Anti-GDF9 / GDF-9 Antibody (Biotin) LS-C319013
Rabbit Polyclonal (IgG) to Human GDF9 / GDF-9
Western blot, ELISA
Biotin Conjugated

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone mAb-GDF9-53] (IgG) to Human GDF9 / GDF-9
Human, Monkey, Bat, Dog
IHC - Paraffin, IHC - Frozen, Western blot, Functional Assay


Human GDF9 / GDF-9
Human, Monkey, Bat, Dog (tested or 100% immunogen sequence identity)
Mouse, Rat, Bovine, Goat, Hamster, Horse, Pig, Rabbit, Sheep, Chicken (at least 90% immunogen sequence identity)
IgG Monoclonal [mAb-GDF9-53]
Protein G purified


  • IHC - Paraffin (1:25 - 1:100)
  • IHC - Frozen
  • Western blot (1:100 - 1:1000)
  • Functional Assay

Specificity and Use

GDF9 / GDF-9 antibody was raised against tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Galago, Marmoset, Shrew, Bat, Dog, Armadillo (100%); Ferret, Sheep, Goat, Panda, Cat, Bovine, Pig, Opossum (97%); Mouse, Rat, Hamster, Rabbit, Horse, Turkey, Zebra finch, Chicken (94%); Elephant (90%); Guinea pig, Xenopus (81%).
Recognizes an epitope within the highly conserved EPDG sequence of GDF9 (growth differentiation factor 9), a homodimeric growth factor and member of the TGF-beta superfamily, closely related to bone morphogenetic proteins (BMPs). GDF9 is specifically expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5). Clone mAb-GDF9-53 recognizes GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity,. Removal of sodium azide is recommended prior to use in functional assays.


PBS, 0.09% sodium azide
+4°C or -20°C, Avoid repeated freezing and thawing.
For research use only.

About GDF9 / GDF-9

O60383 NM_005260 NP_005251.1

GDF9 Antibody, GDF-9 Antibody

Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B.

Western blot

Western blot
GDF9 over expressing lysate probed with Mouse anti-Human GDF9

Requested From: United States
Date Requested: 1/23/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number