LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

GAD65 Antibody LS-C331171

GAD65 antibody LS-C331171 is an unconjugated rabbit polyclonal antibody to GAD65 from human, mouse and rat. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C331171-50
50 µl
$235
LS-C331171-100
100 µl
$315
LS-C331171-200
200 µl
$425
Description
GAD65 antibody LS-C331171 is an unconjugated rabbit polyclonal antibody to GAD65 from human, mouse and rat. Validated for IF, IHC and WB.
Target
Human GAD65
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
GAD65 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 401-585 of human GAD2 (NP_001127838.1). PLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
Specificity
Human GAD65
Usage
The predicted MW is 65kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About GAD65
Q05329 NM_000818 NP_000809.1

Popular GAD65 Products

Anti-GAD2 / GAD65 antibody IHC of human brain, cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 2.5 ug/ml.
Species: Human, Monkey, Mouse
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
GAD65 antibody [C2C3], C-term detects GAD2 protein at cytosol on RT2 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded RT2 xenograft. GAD65 antibody [C2C3], C-term dilution:1:500.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Immunofluorescence of paraformaldehyde-fixed HeLa, using GAD65 antibody at 1:200 dilution.
Species: Human, Mouse, Rat
Applications: ICC, Immunofluorescence, Western blot
Anti-GAD65 antibody IHC staining of human brain, cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Monkey, Rat
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation, Radioimmunoassay
GAD2 Antibody western blot of rat brain tissue lysates (35 ug/lane). The GAD2 antibody detected the GAD2 protein (arrow).
Species: Human, Mouse, Rat
Applications: Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).

Immunofluorescence

Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody.
Western blot analysis of extracts of various cell lines, using GAD2 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).

Immunofluorescence

Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody.
Western blot analysis of extracts of various cell lines, using GAD2 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).

Immunofluorescence

Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody.
Western blot analysis of extracts of various cell lines, using GAD2 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat brain using GAD2 Antibodyat dilution of 1:100 (40x lens).

Immunofluorescence

Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using GAD2 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody.
Western blot analysis of extracts of various cell lines, using GAD2 antibody.

Western blot

Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using GAD2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 2/18/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy