Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
GAA / Alpha‑Glucosidase, Acid Antibody LS‑C661892
Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated mouse monoclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.
100 µg

Popular GAA / Alpha-Glucosidase, Acid Products

MCF7 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Zebrafish
Applications: Western blot
Anti-GAA antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B10678 dilution 1:50.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Western blot of GAA / Alpha-Glucosidase, Acid antibody.
Species: Rat
Applications: IHC, Western blot
Species: Human, Mouse, Rat
Applications: IHC, Western blot, Immunoprecipitation
Species: Human, Mouse
Applications: Western blot

Product Description

Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated mouse monoclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.
About GAA / Alpha-Glucosidase, Acid
GAA / Alpha-Glucosidase, Acid is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene. P10253 NM_000152 NP_000143.2

GAA Antibody, Acid maltase Antibody, Aglucosidase alfa Antibody, Glucosidase, alpha Antibody, Lysosomal alpha-glucosidase Antibody, Glucosidase, alpha acid Antibody, LYAG Antibody


Human GAA / Alpha-Glucosidase, Acid
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)

Requested From: 
Date Requested: 7/19/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number