  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-GAA / Alpha-Glucosidase, Acid Antibody LS-C661892

Catalog Size Price
LS-C661892-100 100 µg Unavailable

Most Popular GAA / Alpha-Glucosidase, Acid Antibodies

Anti-GAA / Alpha-Glucosidase, Acid Antibody (aa218-267) LS-C80648
Rabbit Polyclonal (IgG) to Human GAA / Alpha-Glucosidase, Acid
Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Zebrafish
Western blot
MCF7 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Anti-GAA / Alpha-Glucosidase, Acid Antibody (aa174-203) IHC-plus™ LS-B10678
Rabbit Polyclonal to Human GAA / Alpha-Glucosidase, Acid
IHC, IHC - Paraffin, Western blot
Anti-GAA antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B10678 dilution 1:50.
Anti-GAA / Alpha-Glucosidase, Acid Antibody LS-C307624
Mouse Polyclonal (IgG) to Human GAA / Alpha-Glucosidase, Acid
Western blot
Anti-GAA / Alpha-Glucosidase, Acid Antibody (aa70-225) LS-C373899
Rabbit Polyclonal (IgG) to Rat GAA / Alpha-Glucosidase, Acid
Western blot
Western blot of GAA / Alpha-Glucosidase, Acid antibody.
Anti-GAA / Alpha-Glucosidase, Acid Antibody (HRP) LS-C542248
Rabbit Polyclonal (IgG) to Human GAA / Alpha-Glucosidase, Acid
Human, Mouse
Western blot
HRP Conjugated

100% Guaranteed
Mouse Monoclonal to Human GAA / Alpha-Glucosidase, Acid
IHC, Western blot


Human GAA / Alpha-Glucosidase, Acid
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified


  • IHC
  • Western blot

Specificity and Use

A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.


4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
For research use only.

About GAA / Alpha-Glucosidase, Acid

P10253 NM_000152 NP_000143.2

GAA Antibody, Acid maltase Antibody, Aglucosidase alfa Antibody, Glucosidase, alpha Antibody, Lysosomal alpha-glucosidase Antibody, Glucosidase, alpha acid Antibody, LYAG Antibody

GAA / Alpha-Glucosidase, Acid is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene.

Requested From: 
Date Requested: 4/22/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number