LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
GAA / Alpha‑Glucosidase, Acid Antibody LS‑C661892
Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated mouse monoclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.
Catalog
Size
Price
LS-C661892-100
100 µg
$355
Description
Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated mouse monoclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.
Target
Human GAA / Alpha-Glucosidase, Acid
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Presentation
4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3 per 100ug antibody
Reconstitution
0.2ml of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About GAA / Alpha-Glucosidase, Acid
P10253 NM_000152 NP_000143.2

Popular GAA / Alpha-Glucosidase, Acid Products

Anti-GAA antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:50.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
MCF7 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Zebrafish
Applications: Western blot
Western blot of GAA / Alpha-Glucosidase, Acid antibody.
Species: Rat
Applications: IHC, Western blot
Antibody
Species: Human, Mouse
Applications: Western blot
Antibody
Species: Human, Mouse
Applications: Western blot

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/10/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy