LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-DEFB4A / BD-2 Antibody (aa4-41) LS-C127020


Wt. Vol. Conc. Price
10 µg - - Unavailable

Related Products

57 DEFB4A / BD-2 Antibodies

Most Popular DEFB4A / BD-2 Antibodies

Anti-DEFB4A / BD-2 Antibody (N-Terminus) LS-C35129
Rabbit Polyclonal (IgG) to Human DEFB4A / BD-2
Human, Mouse, Rat
Western blot, ELISA
Anti-DEFB4A / BD-2 Antibody (N-Terminus) LS-C35130
Rabbit Polyclonal (IgG) to Mouse DEFB4A / BD-2
Mouse, Human, Rat
Western blot, ELISA
Anti-DEFB4A / BD-2 Antibody LS-C104580
Goat Polyclonal to Human DEFB4A / BD-2
Western blot, ELISA
Enzyme-Linked Immunosorbent Assay Image
Anti-DEFB4A / BD-2 Antibody LS-C153384
Rabbit Polyclonal to Human DEFB4A / BD-2
IHC, Western blot, ELISA
Anti-DEFB4A / BD-2 Antibody (Internal) IHC-plus™ LS-B13646
Rabbit Polyclonal to Human DEFB4A / BD-2
Human, Mouse, Rat
IHC - Paraffin, Western blot
Immunohistochemistry - Paraffin Image

100% Guaranteed 100% Guaranteed
Sheep Polyclonal (IgG) to Human DEFB4A / BD-2
ELISA, Radioimmunoassay


Human DEFB4A / BD-2
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
IgG Polyclonal
Protein G purified


  • ELISA (1:5000)
  • Radioimmunoassay

Specificity and Use

DEFB4A / BD-2 antibody was raised against synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (97%); Orangutan (81%).
Recognizes human beta-Defensin 2 (epitope: aa 4-41).
Suitable for use in ELISA and RIA. ELISA: 1:5000.


Lyophilized from 50 mM Tris, pH 7.4
Sterile buffer or distilled water
Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About DEFB4A / BD-2

NM_004942 NP_004933.1

DEFB4A Antibody, Beta-defensin 2 Antibody, Beta-defensin 4A Antibody, DEFB-2 Antibody, DEFB102 Antibody, Defensin, beta 2 Antibody, Defensin, beta 4 Antibody, Defensin, beta 4A Antibody, DEFB4 Antibody, DEFB2 Antibody, HBD-2 Antibody, Skin-antimicrobial peptide 1 Antibody, BD-2 Antibody, SAP1 Antibody

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.

Requested From: 
Date Requested: 4/26/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number