Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > CCT3 > LS-C662403
 
Print Page  
Catalog Number Size Price
LS-C662403-10 10 µg $318 
LS-C662403-100 100 µg $470 
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IF analysis of CCT3 using anti-CCT3 antibody CCT3 was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-CCT3 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCT3 Antibody - IF analysis of CCT3 using anti-CCT3 antibody CCT3 was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-CCT3 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCT3 Antibody - Western blot - Anti-CCT3/Tcp 1 Gamma Picoband Antibody
CCT3 Antibody - Flow Cytometry analysis of U251 cells using anti-CCT3 antibody. Overlay histogram showing U251 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCT3 Antibody - Flow Cytometry analysis of PC-3 cells using anti-CCT3 antibody. Overlay histogram showing PC-3 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCT3 Antibody - Flow Cytometry analysis of K562 cells using anti-CCT3 antibody. Overlay histogram showing K562 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IHC analysis of CCT3 using anti-CCT3 antibody. CCT3 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CCT3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CCT3 Antibody - IF analysis of CCT3 using anti-CCT3 antibody CCT3 was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-CCT3 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCT3 Antibody - IF analysis of CCT3 using anti-CCT3 antibody CCT3 was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-CCT3 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCT3 Antibody - Western blot - Anti-CCT3/Tcp 1 Gamma Picoband Antibody
CCT3 Antibody - Flow Cytometry analysis of U251 cells using anti-CCT3 antibody. Overlay histogram showing U251 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCT3 Antibody - Flow Cytometry analysis of PC-3 cells using anti-CCT3 antibody. Overlay histogram showing PC-3 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCT3 Antibody - Flow Cytometry analysis of K562 cells using anti-CCT3 antibody. Overlay histogram showing K562 cells stained with anti-CCT3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Human CCT3 Antibody (IHC, WB) LS‑C662403

Polyclonal Rabbit anti‑Human CCT3 Antibody (IHC, WB) LS‑C662403

Submit Review LSBio Guarantee
Antibody:
CCT3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662403-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
CCT3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CCT3 antibody LS-C662403 is an unconjugated rabbit polyclonal antibody to human CCT3. Validated for Flow, ICC, IHC and WB.
Target
Human CCT3
Synonyms
CCT3 | CCT-gamma | CCTG | HTRiC5 | TCP-1-gamma | TRIC5 | PIG48
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human CCT3 (497-536 aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Applications
  • IHC
  • IHC - Frozen
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCT3
P49368 NM_005998 NP_005989.3

Publications (0)

Submit a Publication for LS-C662403

Customer Reviews (0)

Submit a review for LS-C662403

Featured Products

Product
CCT3 Antibody LS‑C661736
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, Flow Cytometry, ELISA
Product
CCT3 Antibody LS‑C661735
Species: Human
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation, Flow Cytometry, ELISA
CCT3 Antibody - Anti-CCT3 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ CCT3 Antibody (aa557‑570) LS‑B9502
Species: Human, Monkey, Mouse, Bovine, Dog, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
CCT3 Antibody - Immunohistochemistry of paraffin-embedded human colon cancer using antibody at 1:100 dilution.
CCT3 Antibody (aa1‑300) LS‑C375406
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot, ELISA
CCT3 Protein - 12.5% SDS-PAGE of human CCT3 stained with Coomassie Blue
Human CCT3 Protein (Recombinant GST) (Full Length) - LS-G30774
Source: Wheat
Tag: GST
CCT3 Protein - Purified recombinant protein CCT3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human CCT3 Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G67079
Source: Human
Tag: Myc-DDK (Flag)
See all CCT3 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/18/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com