LSBio The Immunohistochemistry Antibody Company
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-CALCB Antibody LS-C127170

Ordering

Wt. Vol. Conc. Price
- 20 µl - $365
- 100 µl - $650
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)
206-374-1102
866-206-6909
Orders@LSBio.com
 

Most Popular CALCB Antibodies

Anti-CALCB Antibody LS-C143674
Rabbit Polyclonal (IgG) to Human CALCB
Human, Rat
IHC, Immunofluorescence
Unconjugated
Anti-CALCB Antibody (aa1-134, Biotin) LS-C299375
Rabbit Polyclonal (IgG) to Rat CALCB
Rat
Western blot, ELISA
Biotin Conjugated
Western blot Image
Anti-CALCB Antibody (aa1-134, FITC) LS-C305422
Rabbit Polyclonal (IgG) to Rat CALCB
Rat
Western blot, ELISA
FITC Conjugated
Western blot Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Human CALCB
Human
Radioimmunoassay
Unconjugated

Details

Human CALCB
Goat
Human (tested or 100% immunogen sequence identity)
Monkey, Mouse, Rat, Dog, Horse, Pig, Sheep (at least 90% immunogen sequence identity)
Polyclonal
Unconjugated
Antiserum
Unmodified

Applications

Radioimmunoassay (1:3000)

Specificity and Use

CALCB antibody was raised against synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Elephant (97%); Sheep, Pig (94%); Mouse, Rat, Dog, Horse (90%); Panda, Salmon, Medaka, Pufferfish (87%); Hamster, Chicken (84%); Zebrafish (81%).
Recognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin.
Suitable for use in RIA. RIA: 1:3000.

Packaging

Lyophilized from PBS, pH 7.2
20 µl or 100 µl Sterile distilled water
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About CALCB

P10092 NP_000719.1

CALCB Antibody, Beta-type CGRP Antibody, Beta-CGRP Antibody, CALC2 Antibody, Calcitonin 2 Antibody, CGRP-II Antibody, CGRP2 Antibody

CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Requested From: United States
Date Requested: 12/4/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number