LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-Brain Natriuretic Peptide 32 Antibody IHC-plus™ LS-B7491

Note: This antibody replaces LS-C149255


Wt. Vol. Conc. Price
200 µg - - $450
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular Brain Natriuretic Peptide 32 Antibodies

Anti-Brain Natriuretic Peptide 32 Antibody LS-C143668
Rabbit Polyclonal (IgG) to Human Brain Natriuretic Peptide 32
Anti-Brain Natriuretic Peptide 32 Antibody LS-C143669
Rabbit Polyclonal (IgG) to Pig Brain Natriuretic Peptide 32
Anti-Brain Natriuretic Peptide 32 Antibody IHC-plus™ LS-B7491
Rabbit Polyclonal (IgG) to Human Brain Natriuretic Peptide 32
IHC - Paraffin, ELISA, Dot Blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human Brain Natriuretic Peptide 32
IHC - Paraffin, ELISA, Dot Blot


Human Brain Natriuretic Peptide 32
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Protein G purified


  • IHC - Paraffin (10 µg/ml)
  • ELISA (1:40000)
  • Dot Blot

Specificity and Use

Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH


Lyophilized from PBS. No preservative added
Reconstitute at 1 mg/ml in PBS
For research use only.

About Brain Natriuretic Peptide 32


Anti-Brain Natriuretic Peptide 32 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7491 concentration 10 ug/ml.


Anti-Brain Natriuretic Peptide 32 antibody IHC of human brain cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7491 concentration 10 ug/ml.

Requested From: United States
Date Requested: 1/18/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number