LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-AIFM1 / AIF / PDCD8 Antibody IHC-plus™ LS-B7901

Note: This antibody replaces LS-C150713

Wt. Vol. Conc. Price
- 100 µl - $395
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular AIFM1 / AIF / PDCD8 Antibodies

Anti-AIFM1 / AIF / PDCD8 Antibody (aa593-606) IHC-plus™ LS-B620
Rabbit Polyclonal to Human AIFM1 / AIF / PDCD8
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-AIFM1 / AIF / PDCD8 Antibody (aa151-169) LS-C147989
Rabbit Polyclonal to Human AIFM1 / AIF / PDCD8
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation
Immunohistochemistry Image
Anti-AIFM1 / AIF / PDCD8 Antibody IHC-plus™ LS-B7901
Rabbit Polyclonal (IgG) to Human AIFM1 / AIF / PDCD8
Human, Mouse, Rat
IHC - Paraffin, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human AIFM1 / AIF / PDCD8
Human, Mouse, Rat
IHC - Paraffin, Western blot

Human AIFM1 / AIF / PDCD8
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified

  • IHC - Paraffin (5 µg/ml)
  • Western blot

Specificity and Use

AIFM1 / AIF / PDCD8 antibody was raised against human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

TBS containing 50% glycerol, 0.5 mg/ml BSA, and 0.02% sodium azide
Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
For research use only.

About AIFM1 / AIF / PDCD8

O95831 NM_004208 NP_004199.1

AIFM1 Antibody, AIF Antibody, COXPD6 Antibody, PDCD8 Antibody, Programmed cell death 8 Antibody

Apoptosis is characterized by several morphological nuclear changes including chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of caspase family, caspase activated DNase, and several novel proteins. A novel gene, the product of which causes chromatin condensation and DNA fragmentation, was recently identified, cloned, and designated apoptosis inducing factor (AIF).

Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.

Requested From: United States
Date Requested: 10/27/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number