LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
AIFM1 / AIF / PDCD8 Antibody IHC‑plus™ LS‑B7901
Note: This antibody replaces LS-C150713
PDCD8 antibody LS-B7901 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B7901-100
100 µl
Unavailable

Popular AIFM1 / AIF / PDCD8 Products

Anti-AIFM1 / AIF antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B620 concentration 20 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot
Anti-AIFM1 / AIF antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1508 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
Anti-AIFM1 / AIF antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B3765 concentration 5 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, ICC, Western blot, ELISA
IHC of AIF in formalin-fixed, paraffin-embedded normal human colon using LS-C147989 at 1:2000. Hematoxylin-Eosin counterstain. In this example, AIF expression is predominant in the upper part of the crypt.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation

Product Description

PDCD8 antibody LS-B7901 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
About AIFM1 / AIF / PDCD8
Apoptosis is characterized by several morphological nuclear changes including chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of caspase family, caspase activated DNase, and several novel proteins. A novel gene, the product of which causes chromatin condensation and DNA fragmentation, was recently identified, cloned, and designated apoptosis inducing factor (AIF). O95831 NM_004208 NP_004199.1

AIFM1 Antibody, AIF Antibody, COXPD6 Antibody, PDCD8 Antibody, Programmed cell death 8 Antibody


Specifications

Target
Human AIFM1 / AIF / PDCD8
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (5 µg/ml)
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
Presentation
TBS containing 50% glycerol, 0.5 mg/ml BSA, and 0.02% sodium azide
Storage
Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images


Immunohistochemistry

Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.

Immunohistochemistry

Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.

Immunohistochemistry

Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.

Immunohistochemistry

Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7901 dilution 5 ug/ml.


Requested From: 
Date Requested: 6/19/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number