Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

AGER / RAGE Antibody (aa91-120) LS-C407683

RAGE antibody LS-C407683 is an unconjugated rabbit polyclonal antibody to RAGE (AGER) from human, mouse and rat. Validated for IHC and WB.
100 µg
RAGE antibody LS-C407683 is an unconjugated rabbit polyclonal antibody to RAGE (AGER) from human, mouse and rat. Validated for IHC and WB.
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
AGER / RAGE antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
Endothelial cells.
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
Q15109 NM_001136 NP_001127.1

Popular AGER / RAGE Products

Species: Human, Mouse
Applications: IHC, Western blot, Flow Cytometry, ELISA
Species: Human, Mouse
Applications: IHC, Western blot, Flow Cytometry, ELISA
Anti-RAGE antibody IHC of human lung. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Bovine
Applications: IHC, IHC - Paraffin, ICC, Western blot, ELISA
Anti-AGER / RAGE antibody IHC of human lung. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 10 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Species: Mouse
Applications: Western blot, ELISA

Publications (0)

Customer Reviews (0)



RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.


RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.


RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.

Western blot

RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.


RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.


RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.


RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.

Western blot

RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.


RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.


RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.


RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.

Western blot

RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.


RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Rat Lung Tissue.


RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RAGE antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.


RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.
RAGE antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.

Western blot

RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.

Requested From: United States
Date Requested: 3/26/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy