LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
ADGRE2 / EMR2 Antibody LS‑C749282
EMR2 antibody LS-C749282 is an unconjugated rabbit polyclonal antibody to EMR2 (ADGRE2) from human and mouse. Validated for WB.
Catalog
Size
Price
LS-C749282-50
50 µl
$235
Description
EMR2 antibody LS-C749282 is an unconjugated rabbit polyclonal antibody to EMR2 (ADGRE2) from human and mouse. Validated for WB.
Target
Human ADGRE2 / EMR2
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
ADGRE2 / EMR2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 300-500 of human EMR2 (NP_038475.2). TIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGC
Usage
The predicted MW is 74kDa/80kDa/84kDa/85kDa/89kDa/90kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About ADGRE2 / EMR2
Q9UHX3 NM_013447 NP_038475.2

Popular ADGRE2 / EMR2 Products

Anti-EMR2 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
Anti-EMR2 antibody IHC of human lung, neutrophils. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Human
Applications: IHC, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry
Immunocytochemistry Image
Species: Human
Applications: IHC, IHC - Paraffin, ICC, ELISA
Anti-EMR2 antibody IHC of human lung, respiratory epithelium. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/18/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy