LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • Dna-Binding ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Antibody Reports
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C191402 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



VCL / Vinculin Antibodies

vinculin

Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. Human vinculin protein exhibits a greater than 95% sequence identity to the chicken vinculin protein.

Gene Name: vinculin
Family/Subfamily: Cytoskeleton
Synonyms: VCL Antibody, CMD1W Antibody, CMH15 Antibody, Metavinculin Antibody, Vinculin Antibody, MVCL Antibody
Target Sequences: NM_014000 NP_054706.1 P18206
 VCL / Vinculin Feature Table
Featured Image

Featured VCL / Vinculin Antibody

LS-B5770 is a rabbit polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.


VCL / Vinculin Antibodies (56)

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC-P, IF, WB, ELISA aa786-835 No Primary
Anti-VCL / Vinculin Antibody (aa786-835) IHC-plus™ LS-B5770
IHC Image
IHC Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human IHC-P, WB, ELISA aa356-607 No Primary
Anti-VCL / Vinculin Antibody (aa356-607) IHC-plus™ LS-B9609
IHC Image
WB Image
Rabbit Polyclonal to Human VCL / Vinculin
Human
IHC - Paraffin, Western blot, ELISA
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human IHC-P, WB No Primary
Anti-VCL / Vinculin Antibody IHC-plus™ LS-B4848
IHC Image
IHC Image
Rabbit Polyclonal to Human VCL / Vinculin
Human
IHC - Paraffin, Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Human IHC-P, IF, WB, IP No Primary
Anti-VCL / Vinculin Antibody IHC-plus™ LS-B4764
IHC Image
IHC Image
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC-P, IF, WB, ELISA C-Terminus No Primary
Anti-VCL / Vinculin Antibody (C-Terminus) IHC-plus™ LS-B10133
IHC Image
IF Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Unconjugated
VCL / Vinculin Mouse IgG Monoclonal VLN01 Unconjugated Human IHC-P, IF, WB, IP No Primary
Anti-VCL / Vinculin Antibody (clone VLN01) IHC-plus™ LS-B8515
IHC Image
Mouse Monoclonal [clone VLN01] (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Biotin Conjugated Human WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (Biotin) LS-C211451
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
Western blot, ELISA
Biotin Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal 10B2533 Unconjugated, Azide-free Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, clone 10B2533, Azide-free) LS-C183723
Mouse Monoclonal [clone 10B2533] (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
Unconjugated, Azide-free
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse, Chicken WB, IP pTyr1065 No Primary
Anti-VCL / Vinculin Antibody (phospho-Tyr1065) LS-C40219
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse, Chicken
Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Rabbit IgG Monoclonal SP117 Unconjugated Human IHC-P C-Terminus No Primary
Anti-VCL / Vinculin Antibody (C-Terminus, clone SP117) LS-C210362
IHC Image
IHC Image
Rabbit Monoclonal [clone SP117] (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse IHC-P, WB N-Terminus No Primary
Anti-VCL / Vinculin Antibody (N-Terminus) LS-C100624
IHC Image
WB Image
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse
IHC - Paraffin, Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat, Bovine, Horse, Pig, Rabbit, Chicken, Zebrafish IHC-P, IF, WB, IP aa1016-1066 No
Anti-VCL / Vinculin Antibody (aa1016-1066) LS-C289271
IHC Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Mouse, Rat, Bovine, Horse, Pig, Rabbit, Chicken, Zebrafish
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC, IF, ELISA pTyr821 No Primary
Anti-VCL / Vinculin Antibody (phospho-Tyr821) LS-C199725
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Mouse, Rat
IHC, Immunofluorescence, ELISA
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse, Rat IHC, IF, WB Leu817 No Primary
Anti-VCL / Vinculin Antibody (Leu817) LS-C176564
IHC Image
WB Image
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse, Rat
IHC, Immunofluorescence, Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Rat, Bovine, Horse, Pig, Rabbit, Chicken, Zebrafish IHC-P, IF aa1016-1066 No
Anti-VCL / Vinculin Antibody (aa1016-1066) LS-C286911
IHC Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Rat, Bovine, Horse, Pig, Rabbit, Chicken, Zebrafish
IHC - Paraffin, Immunofluorescence
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human IHC-P C-Terminus No Primary
Anti-VCL / Vinculin Antibody (C-Terminus) LS-C210565
IHC Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human IHC-P, IHC-Fr, ICC, WB, ELISA aa1020-1134 No
Anti-VCL / Vinculin Antibody (aa1020-1134) LS-C299575
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin, IHC - Frozen, ICC, Western blot, ELISA
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human IHC-P, IHC-Fr, ICC, WB, ELISA aa1020-1134 No
Anti-VCL / Vinculin Antibody (aa1020-1134) LS-C296985
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin, IHC - Frozen, ICC, Western blot, ELISA
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Human, Mouse, Rat, Rabbit, Chicken IHC-P, IHC-Fr, IP, Flo No Primary
Anti-VCL / Vinculin Antibody LS-C40211
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Rabbit, Chicken
IHC - Paraffin, IHC - Frozen, Immunoprecipitation, Flow Cytometry
Unconjugated
VCL / Vinculin Mouse IgG Monoclonal Unconjugated Chicken, Human, Monkey, Rat, Hamster IHC-P, IHC-Fr, IF, WB No Primary
Anti-VCL / Vinculin Antibody LS-C124792
Mouse Monoclonal (IgG) to Chicken VCL / Vinculin
Chicken, Human, Monkey, Rat, Hamster
IHC - Paraffin, IHC - Frozen, Immunofluorescence, Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human IHC, ICC, IF, WB aa1020-1134 No
Anti-VCL / Vinculin Antibody (aa1020-1134) LS-C303819
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC, ICC, Immunofluorescence, Western blot
Unconjugated
VCL / Vinculin Mouse IgG Monoclonal VLN01 Unconjugated, Azide-free Human IHC-P, IF, WB, IP No Primary
Anti-VCL / Vinculin Antibody (clone VLN01, Azide-free) LS-C87611
Mouse Monoclonal [clone VLN01] (IgG) to Human VCL / Vinculin
Human
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Unconjugated, Azide-free
VCL / Vinculin Rabbit IgG Polyclonal HRP Conjugated Human IHC, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (HRP) LS-C212066
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC, Western blot, ELISA
HRP Conjugated
VCL / Vinculin Rabbit IgG Polyclonal FITC Conjugated Human IHC, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (FITC) LS-C212068
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC, Western blot, ELISA
FITC Conjugated
VCL / Vinculin Rabbit IgG Polyclonal Biotin Conjugated Human IHC, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (Biotin) LS-C212070
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC, Western blot, ELISA
Biotin Conjugated
VCL / Vinculin Mouse IgG Monoclonal MaVinc Unconjugated Human, Monkey, Rat, Hamster IHC-Fr, IF, WB No Primary
Anti-VCL / Vinculin Antibody (clone MaVinc) LS-C11489
Mouse Monoclonal [clone MaVinc] (IgG) to Human VCL / Vinculin
Human, Monkey, Rat, Hamster
IHC - Frozen, Immunofluorescence, Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal 489220 Unconjugated Human, Mouse, Rat, Rabbit, Sheep, Chicken IHC, ICC, WB No Primary
Anti-VCL / Vinculin Antibody (clone 489220) LS-C195330
Mouse Monoclonal [clone 489220] (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Rabbit, Sheep, Chicken
IHC, ICC, Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human IHC, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody LS-C212065
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
IHC, Western blot, ELISA
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal VIN-54 Unconjugated Human, Mouse, Rat, Chicken IHC-Fr, WB No Primary
Anti-VCL / Vinculin Antibody (clone VIN-54) LS-C171297
Mouse Monoclonal [clone VIN-54] (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Chicken
IHC - Frozen, Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal FB11 Unconjugated Human IHC-Fr, WB No Primary
Anti-VCL / Vinculin Antibody (clone FB11) LS-C202542
Mouse Monoclonal [clone FB11] (IgG1) to Human VCL / Vinculin
Human
IHC - Frozen, Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Human, Mouse, Rat, Rabbit, Chicken IHC-Fr, ICC, WB, IP No Primary
Anti-VCL / Vinculin Antibody LS-C40210
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Rabbit, Chicken
IHC - Frozen, ICC, Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal FB11 Unconjugated Human IHC-Fr, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (clone FB11) LS-C124794
Mouse Monoclonal [clone FB11] (IgG1) to Human VCL / Vinculin
Human
IHC - Frozen, Western blot, ELISA
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Human, Mouse, Rat, Bovine, Dog, Chicken, Xenopus IHC-Fr, IF, WB No Primary
Anti-VCL / Vinculin Antibody LS-C92431
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Bovine, Dog, Chicken, Xenopus
IHC - Frozen, Immunofluorescence, Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Human, Mouse, Rat, Rabbit, Chicken IHC-Fr, WB No Primary
Anti-VCL / Vinculin Antibody LS-C124793
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Rabbit, Chicken
IHC - Frozen, Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Monoclonal EPR8185 Unconjugated Human, Mouse, Rat ICC, IF, WB, IP Internal No Primary
Anti-VCL / Vinculin Antibody (Internal, clone EPR8185) LS-C154484
IF Image
WB Image
Rabbit Monoclonal [clone EPR8185] (IgG) to Human VCL / Vinculin
Human, Mouse, Rat
ICC, Immunofluorescence, Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Mouse IgG1,k Monoclonal 2C6-1B5 Unconjugated Human IF, WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (clone 2C6-1B5) LS-C198423
IF Image
WB Image
Mouse Monoclonal [clone 2C6-1B5] (IgG1,k) to Human VCL / Vinculin
Human
Immunofluorescence, Western blot, ELISA
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse WB C-Terminus No Primary
Anti-VCL / Vinculin Antibody (C-Terminus) LS-C100625
WB Image
WB Image
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse
Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Chicken, Zebrafish WB aa750-800 No
Anti-VCL / Vinculin Antibody (aa750-800) LS-C289272
WB Image
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Chicken, Zebrafish
Western blot
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Chicken, Zebrafish WB aa873-922 No Primary
Anti-VCL / Vinculin Antibody (aa873-922) LS-C135920
WB Image
Rabbit Polyclonal to Human VCL / Vinculin
Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Chicken, Zebrafish
Western blot
Unconjugated
VCL / Vinculin Rabbit IgG Polyclonal FITC Conjugated Human WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (FITC) LS-C211450
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
Western blot, ELISA
FITC Conjugated
VCL / Vinculin Rabbit IgG Polyclonal HRP Conjugated Human WB, ELISA No Primary
Anti-VCL / Vinculin Antibody (HRP) LS-C211449
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
Western blot, ELISA
HRP Conjugated
VCL / Vinculin Rabbit IgG Polyclonal Unconjugated Human WB, ELISA No Primary
Anti-VCL / Vinculin Antibody LS-C211448
Rabbit Polyclonal (IgG) to Human VCL / Vinculin
Human
Western blot, ELISA
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal VIN-54 Sepharose Conjugated Human, Mouse, Rat, Chicken IP No Primary
Anti-VCL / Vinculin Antibody (clone VIN-54, Sepharose) LS-C171299
Mouse Monoclonal [clone VIN-54] (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Chicken
Immunoprecipitation
Sepharose Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal VIN-54 Magnetic beads Conjugated Human, Mouse, Rat, Chicken IP No Primary
Anti-VCL / Vinculin Antibody (clone VIN-54, Magnetic beads) LS-C171298
Mouse Monoclonal [clone VIN-54] (IgG1) to Human VCL / Vinculin
Human, Mouse, Rat, Chicken
Immunoprecipitation
Magnetic beads Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal V284 Unconjugated Human WB No Primary
Anti-VCL / Vinculin Antibody (clone V284) LS-C85522
Mouse Monoclonal [clone V284] (IgG1) to Human VCL / Vinculin
Human
Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal V284 Unconjugated Human, Rabbit No Primary
Anti-VCL / Vinculin Antibody (clone V284) LS-C95445
Mouse Monoclonal [clone V284] (IgG1) to Human VCL / Vinculin
Human, Rabbit
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal HRP Conjugated, Azide-free Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, Azide-free, HRP) LS-C284242
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
HRP Conjugated, Azide-free
VCL / Vinculin Mouse IgG1 Monoclonal FITC Conjugated Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, FITC) LS-C284243
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
FITC Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal PE Conjugated Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, PE) LS-C284244
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
PE Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal APC Conjugated Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, APC) LS-C284239
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
APC Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal AP Conjugated Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, AP) LS-C284240
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
AP Conjugated
VCL / Vinculin Mouse IgG1 Monoclonal Biotin Conjugated Human ICC, WB, ELISA aa1-1067 No Primary
Anti-VCL / Vinculin Antibody (aa1-1067, Biotin) LS-C284241
Mouse Monoclonal (IgG1) to Human VCL / Vinculin
Human
ICC, Western blot, ELISA
Biotin Conjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse, Chicken WB, IP pTyr100 No Primary
Anti-VCL / Vinculin Antibody (phospho-Tyr100) LS-C40217
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse, Chicken
Western blot, Immunoprecipitation
Unconjugated
VCL / Vinculin Mouse IgG Monoclonal VIN-54 Unconjugated Human, Mouse, Rat, Chicken WB No Primary
Anti-VCL / Vinculin Antibody (clone VIN-54) LS-C124795
Mouse Monoclonal [clone VIN-54] (IgG) to Human VCL / Vinculin
Human, Mouse, Rat, Chicken
Western blot
Unconjugated
VCL / Vinculin Mouse IgG1 Monoclonal Unconjugated Chicken, Human, Mouse, Bovine IF No Primary
Anti-VCL / Vinculin Antibody LS-C92429
Mouse Monoclonal (IgG1) to Chicken VCL / Vinculin
Chicken, Human, Mouse, Bovine
Immunofluorescence
Unconjugated
VCL / Vinculin Rabbit Polyclonal Unconjugated Human, Mouse, Rat, Chicken WB pTyr822 No Primary
Anti-VCL / Vinculin Antibody (phospho-Tyr822) LS-C40218
Rabbit Polyclonal to Human VCL / Vinculin
Human, Mouse, Rat, Chicken
Western blot
Unconjugated

VCL / Vinculin Feature Table


Feature Type Location Details
alternative products 1 - 1134 Event=Alternative splicing; Named isoforms=3; Name=2; Synonyms=Metavinculin; IsoId=P18206-1; Sequence=Displayed; Name=1; Synonyms=Vinculin; IsoId=P18206-2; Sequence=VSP_006731; Name=3; IsoId=P18206-3; Sequence=VSP_011857, VSP_011858, VSP_011859; Note=No experimental confirmation available;
Disease 1 - 1134 Defects in VCL are the cause of cardiomyopathy dilated type 1W (CMD1W) [MIM:611407]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
Function 1 - 1134 Involved in cell adhesion. May be involved in the attachment of the actin-based microfilaments to the plasma membrane. May also play important roles in cell morphology and locomotion.
interaction 1 - 1134 P54939:TLN1 (xeno); NbExp=1; IntAct=EBI-716775, EBI-1035421;
ptm 1 - 1134 Aceylated; mainly by myristic acid but also small amount of palmitic acid (By similarity).
ptm 1 - 1134 Phosphorylated; on serines, threonines and tyrosines. Phosphorylation on Tyr-1133 in activated platelets affects head- tail interactions and cell spreading but has no effect on actin binding nor on localization to focal adhesion plaques (By similarity).
Similarity 1 - 1134 Belongs to the vinculin/alpha-catenin family.
Subcellular Location 1 - 1134 Cytoplasm, cytoskeleton. Cell junction, adherens junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Cytoplasmic face of adhesion plaques.
Subunit 1 - 1134 Exhibits self-association properties. Interacts with NRAP and SORBS1 (By similarity). Interacts with TLN1. Interacts with SYNM.
Tissue Specificity 1 - 1134 Metavinculin is muscle-specific.
web resource 1 - 1134 Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/VCL";
web resource 1 - 1134 Name=Wikipedia; Note=Vinculin entry; URL="http://en.wikipedia.org/wiki/Vinculin";
aarhus/ghent-2dpage 1 - 1134 3708
arrayexpress 1 - 1134 P18206
bgee 1 - 1134 P18206
cleanex 1 - 1134 HS_VCL
ctd 1 - 1134 7414
dip 1 - 1134 DIP-35570N
doi 1 - 1134 10
dosac-cobs-2dpage 1 - 1134 P18206
eggnog 1 - 1134 prNOG17973
embl 1 - 1134 AL596247
embl 1 - 1134 AL731576
embl 1 - 1134 BC039174
embl 1 - 1134 BX537994
embl 1 - 1134 L04933
embl 1 - 1134 M33308
embl 1 - 1134 S87175
embl 1 - 1134 S87178
embl 1 - 1134 S87180
embl 1 - 1134 S87218
embl 1 - 1134 S87223
ensembl 1 - 1134 ENST00000211998
genecards 1 - 1134 GC10P075757
geneid 1 - 1134 7414
genevestigator 1 - 1134 P18206
germonline 1 - 1134 ENSG00000035403
go 1 - 1134 GO:0002166
go 1 - 1134 GO:0003779
go 1 - 1134 GO:0005198
go 1 - 1134 GO:0005576
go 1 - 1134 GO:0005829
go 1 - 1134 GO:0005925
go 1 - 1134 GO:0006928
go 1 - 1134 GO:0006936
go 1 - 1134 GO:0007155
go 1 - 1134 GO:0030032
go 1 - 1134 GO:0030336
go 1 - 1134 GO:0043034
go 1 - 1134 GO:0043297
go 1 - 1134 GO:0045294
hgnc 1 - 1134 HGNC:12665
hogenom 1 - 1134 HBG358349
hovergen 1 - 1134 HBG079758
hpa 1 - 1134 CAB002453
hpa 1 - 1134 HPA002131
inparanoid 1 - 1134 P18206
intact 1 - 1134 P18206
interpro 1 - 1134 IPR000633
interpro 1 - 1134 IPR006077
interpro 1 - 1134 IPR017997
ipi 1 - 1134 IPI00291175
ipi 1 - 1134 IPI00307162
ipi 1 - 1134 IPI00384973
kegg 1 - 1134 hsa:7414
medline 1 - 1134 22608298
medline 1 - 1134 90332642
medline 1 - 1134 92174935
medline 1 - 1134 93179440
mim 1 - 1134 193065
mim 1 - 1134 611407
mint 1 - 1134 MINT-92846
nextbio 1 - 1134 29028
ogp 1 - 1134 P18206
oma 1 - 1134 VILHEEA
orphanet 1 - 1134 154
orthodb 1 - 1134 EOG90VZ86
pathway_interaction_db 1 - 1134 avb3_integrin_pathway
pathway_interaction_db 1 - 1134 vegfr1_2_pathway
pdb 1 - 1134 1RKC
pdb 1 - 1134 1RKE
pdb 1 - 1134 1SYQ
pdb 1 - 1134 1TR2
pdb 1 - 1134 1YDI
pdb 1 - 1134 2GWW
pdb 1 - 1134 2HSQ
pdb 1 - 1134 2IBF
pdb 1 - 1134 3H2U
pdb 1 - 1134 3H2V
pdb 1 - 1134 3MYI
pdbsum 1 - 1134 1RKC
pdbsum 1 - 1134 1RKE
pdbsum 1 - 1134 1SYQ
pdbsum 1 - 1134 1TR2
pdbsum 1 - 1134 1YDI
pdbsum 1 - 1134 2GWW
pdbsum 1 - 1134 2HSQ
pdbsum 1 - 1134 2IBF
pdbsum 1 - 1134 3H2U
pdbsum 1 - 1134 3H2V
pdbsum 1 - 1134 3MYI
pfam 1 - 1134 PF01044
pharmgkb 1 - 1134 PA37288
phosphosite 1 - 1134 P18206
phylomedb 1 - 1134 P18206
pir 1 - 1134 A35955
pride 1 - 1134 P18206
prints 1 - 1134 PR00806
prosite 1 - 1134 PS00663
prosite 1 - 1134 PS00664
proteinmodelportal 1 - 1134 P18206
pubmed 1 - 1134 11815424
pubmed 1 - 1134 12665801
pubmed 1 - 1134 1339348
pubmed 1 - 1134 14702644
pubmed 1 - 1134 15070891
pubmed 1 - 1134 15164054
pubmed 1 - 1134 15229287
pubmed 1 - 1134 15489334
pubmed 1 - 1134 16097034
pubmed 1 - 1134 16236538
pubmed 1 - 1134 16712796
pubmed 1 - 1134 17081983
pubmed 1 - 1134 17389395
pubmed 1 - 1134 17974005
pubmed 1 - 1134 18028034
pubmed 1 - 1134 18083107
pubmed 1 - 1134 18669648
pubmed 1 - 1134 19534553
pubmed 1 - 1134 19608861
pubmed 1 - 1134 2116004
pubmed 1 - 1134 8440716
reactome 1 - 1134 REACT_17044
reactome 1 - 1134 REACT_604
refseq 1 - 1134 NP_003364.1
refseq 1 - 1134 NP_054706.1
reproduction-2dpage 1 - 1134 IPI00291175
string 1 - 1134 P18206
supfam 1 - 1134 SSF47220
swiss-2dpage 1 - 1134 P18206
ucd-2dpage 1 - 1134 P18206
ucsc 1 - 1134 uc001jwd.1
ucsc 1 - 1134 uc001jwe.1
unigene 1 - 1134 Hs.643896
joined; genomic_dna 1 - 1134 AAB21656.1
joined; genomic_dna 1 - 1134 AAB21657.1
joined; genomic_dna 1 - 1134 CAI13972.1
joined; genomic_dna 1 - 1134 CAI39673.1
chain 2 - 1134 Vinculin /FTId=PRO_0000064252.
compbias 837 - 878 Pro-rich
init_met 1 - 1 Removed
Modification 100 - 100 Phosphotyrosine (By similarity)
Modification 173 - 173 N6-acetyllysine
Modification 290 - 290 Phosphoserine
Modification 324 - 324 Phosphothreonine (By similarity)
Modification 496 - 496 N6-acetyllysine
Modification 508 - 508 Phosphothreonine
Modification 537 - 537 Phosphotyrosine (Potential)
Modification 604 - 604 Phosphothreonine
Modification 692 - 692 Phosphotyrosine
Modification 721 - 721 Phosphoserine
Modification 774 - 774 Phosphoserine (By similarity)
Modification 822 - 822 Phosphotyrosine
Modification 1133 - 1133 Phosphotyrosine; by SRC-type Tyr-kinases
region 168 - 208 Talin-interaction (By similarity)
region 259 - 589 3 X 112 AA tandem repeats
repeat 259 - 369 1
repeat 370 - 479 2
repeat 480 - 589 3
var_seq 1 - 73 Missing (in isoform 3) /FTId=VSP_011857.
var_seq 262 - 295 DTEAMKRALASIDSKLNQAKGWLRDPSASPGDAG -> VRV LSGEISKIPNSPWLGVLIGTCLILYLVIFVA (in isoform 3). /FTId=VSP_011858.
var_seq 296 - 1134 Missing (in isoform 3) /FTId=VSP_011859.
var_seq 916 - 983 Missing (in isoform 1) /FTId=VSP_006731.
variant 234 - 234 V -> L (in dbSNP:rs17853882) /FTId=VAR_037667.
variant 277 - 277 L -> M (in CMD1W) /FTId=VAR_035101.
variant 934 - 934 A -> V (in dbSNP:rs16931179) /FTId=VAR_035102.
variant 943 - 943 P -> A /FTId=VAR_035103.
variant 954 - 954 Missing (in CMD1W) /FTId=VAR_035104.
variant 975 - 975 R -> W (in CMD1W; significantly alters metavinculin-mediated cross-linking of actin filaments). /FTId=VAR_035105.
keyword 1 - 1134 3D-structure
keyword 1 - 1134 Acetylation
keyword 1 - 1134 Actin-binding
keyword 1 - 1134 Alternative splicing
keyword 1 - 1134 Cardiomyopathy
keyword 1 - 1134 Cell adhesion
keyword 1 - 1134 Cell junction
keyword 1 - 1134 Cell membrane
keyword 1 - 1134 Complete proteome
keyword 1 - 1134 Cytoplasm
keyword 1 - 1134 Cytoskeleton
keyword 1 - 1134 Direct protein sequencing
keyword 1 - 1134 Disease mutation
keyword 1 - 1134 Lipoprotein
keyword 1 - 1134 Membrane
keyword 1 - 1134 Myristate
keyword 1 - 1134 Palmitate
keyword 1 - 1134 Phosphoprotein
keyword 1 - 1134 Polymorphism
keyword 1 - 1134 Repeat
Molecular Weight 1 - 1134 123799
3 hits 1 - 1134 PF01044
1 hit 1 - 1134 PS00663
3 hits 1 - 1134 PS00664

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2014 LifeSpan BioSciences, Inc. All Rights Reserved