LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
    • Blocking Peptides
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • DNA-Binding ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Antibody Reports
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C283420 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



TBX5 Antibodies

T-box 5

Gene Name: T-box 5
Synonyms: TBX5 Antibody, Hos Antibody, T-box protein 5 Antibody, T-box 5 Antibody
Target Sequences: NM_000192 NP_000183.2 Q99593
 TBX5 Feature Table
Featured Image

Featured TBX5 Antibody

LS-B3503 is a rabbit polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.


TBX5 Antibodies (21)

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
TBX5 Rabbit IgG Polyclonal Unconjugated Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish IHC-P, WB aa174-223 No Primary
Anti-TBX5 Antibody (aa174-223) IHC-plus™ LS-B3503
IHC Image
IHC Image
Rabbit Polyclonal (IgG) to Human TBX5
Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish
IHC - Paraffin, Western blot
Unconjugated
TBX5 Rabbit Polyclonal Unconjugated Human IHC-P, WB aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30) LS-C161753
IHC Image
WB Image
Rabbit Polyclonal to Human TBX5
Human
IHC - Paraffin, Western blot
Unconjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Human, Chimpanzee, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit IHC, WB aa249-298 No Primary
Anti-TBX5 Antibody (aa249-298) LS-C29780
WB Image
Rabbit Polyclonal (IgG) to Human TBX5
Human, Chimpanzee, Monkey, Bat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit
IHC, Western blot
Unconjugated
TBX5 Rabbit IgG Polyclonal FITC Conjugated Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, FITC) LS-C271143
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
FITC Conjugated
TBX5 Rabbit IgG Polyclonal HRP Conjugated, Azide-free Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, Azide-free, HRP) LS-C271144
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
HRP Conjugated, Azide-free
TBX5 Rabbit IgG Polyclonal PE Conjugated Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, PE) LS-C271146
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
PE Conjugated
TBX5 Rabbit IgG Polyclonal APC Conjugated Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, APC) LS-C271142
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
APC Conjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Human IHC, WB, ELISA aa1-30 No
Anti-TBX5 Antibody (aa1-30) LS-C325624
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
Unconjugated
TBX5 Rabbit IgG Polyclonal AP Conjugated Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, AP) LS-C271140
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
AP Conjugated
TBX5 Rabbit IgG Polyclonal Biotin Conjugated Human IHC, WB, ELISA aa1-30 No Primary
Anti-TBX5 Antibody (aa1-30, Biotin) LS-C271141
Rabbit Polyclonal (IgG) to Human TBX5
Human
IHC, Western blot, ELISA
Biotin Conjugated
TBX5 Mouse IgG1,k Monoclonal 1G10 Unconjugated Human WB, ELISA, RNAi No Primary
Anti-TBX5 Antibody (clone 1G10) LS-C198307
WB Image
RNAi Image
Mouse Monoclonal [clone 1G10] (IgG1,k) to Human TBX5
Human
Western blot, ELISA, RNA interference
Unconjugated
TBX5 Mouse IgG1 Monoclonal 7B11 Unconjugated Human WB, ELISA No Primary
Anti-TBX5 Antibody (clone 7B11) LS-C108733
WB Image
Mouse Monoclonal [clone 7B11] (IgG1) to Human TBX5
Human
Western blot, ELISA
Unconjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish WB aa124-173 No Primary
Anti-TBX5 Antibody (aa124-173) LS-C31655
WB Image
Rabbit Polyclonal (IgG) to Human TBX5
Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Dog, Goat, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep, Chicken, Xenopus, Zebrafish
Western blot
Unconjugated
TBX5 Rabbit Polyclonal Unconjugated Mouse, Human WB N-Terminus No Primary
Anti-TBX5 Antibody (N-Terminus) LS-C170149
WB Image
Rabbit Polyclonal to Mouse TBX5
Mouse, Human
Western blot
Unconjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Zebrafish ELISA C-Terminus No Primary
Anti-TBX5 Antibody (C-Terminus) LS-C210193
Rabbit Polyclonal (IgG) to Zebrafish TBX5
Zebrafish
ELISA
Unconjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Zebrafish ELISA N-Terminus No Primary
Anti-TBX5 Antibody (N-Terminus) LS-C210194
Rabbit Polyclonal (IgG) to Zebrafish TBX5
Zebrafish
ELISA
Unconjugated
TBX5 Rabbit Polyclonal Unconjugated Human, Monkey ELISA aa21-36 No Primary
Anti-TBX5 Antibody (aa21-36) LS-C3212
Rabbit Polyclonal to Human TBX5
Human, Monkey
ELISA
Unconjugated
TBX5 Rabbit Polyclonal Unconjugated Human, Gibbon, Monkey ELISA aa471-487 No Primary
Anti-TBX5 Antibody (aa471-487) LS-C3213
Rabbit Polyclonal to Human TBX5
Human, Gibbon, Monkey
ELISA
Unconjugated
TBX5 Mouse IgG1 Monoclonal Unconjugated, Azide-free Human WB, ELISA aa402-519 No
Anti-TBX5 Antibody (aa402-519, Azide-free) LS-C328851
Mouse Monoclonal (IgG1) to Human TBX5
Human
Western blot, ELISA
Unconjugated, Azide-free
TBX5 Rabbit IgG Polyclonal Unconjugated Zebrafish, Fish ELISA N-Terminus No Primary
Anti-TBX5 Antibody (N-Terminus) LS-C182479
Rabbit Polyclonal (IgG) to Zebrafish TBX5
Zebrafish, Fish
ELISA
Unconjugated
TBX5 Rabbit IgG Polyclonal Unconjugated Zebrafish, Fish ELISA C-Terminus No Primary
Anti-TBX5 Antibody (C-Terminus) LS-C182478
Rabbit Polyclonal (IgG) to Zebrafish TBX5
Zebrafish, Fish
ELISA
Unconjugated

TBX5 Feature Table


Feature Type Location Details
alternative products 1 - 518 Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=Q99593-1; Sequence=Displayed; Name=Short; IsoId=Q99593-2; Sequence=VSP_006387, VSP_006388;
Disease 1 - 518 Defects in TBX5 are the cause of Holt-Oram syndrome (HOS) [MIM:142900]. HOS is a developmental disorder affecting the heart and upper limbs. It is characterized by thumb anomaly and atrial septal defects.
Function 1 - 518 Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
interaction 1 - 518 Q08369:Gata4 (xeno); NbExp=1; IntAct=EBI-297043, EBI-297008; P52952:NKX2-5; NbExp=2; IntAct=EBI-297043, EBI-936601; P42582:Nkx2-5 (xeno); NbExp=1; IntAct=EBI-297043, EBI-297021; Q9EPK5:Wwtr1 (xeno); NbExp=1; IntAct=EBI-297043, EBI-1211920;
Similarity 1 - 518 Contains 1 T-box DNA-binding domain.
Subcellular Location 1 - 518 Nucleus (Potential).
web resource 1 - 518 Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/TBX5";
arrayexpress 1 - 518 Q99593
bgee 1 - 518 Q99593
cleanex 1 - 518 HS_TBX5
ctd 1 - 518 6910
doi 1 - 518 10
eggnog 1 - 518 prNOG12223
embl 1 - 518 AF221714
embl 1 - 518 BC027942
embl 1 - 518 U80987
embl 1 - 518 U89353
embl 1 - 518 Y09445
ensembl 1 - 518 ENST00000310346
ensembl 1 - 518 ENST00000405440
gene3d 1 - 518 G3DSA:2.60.40.820
genecards 1 - 518 GC12M114791
geneid 1 - 518 6910
genevestigator 1 - 518 Q99593
germonline 1 - 518 ENSG00000089225
go 1 - 518 GO:0003700
go 1 - 518 GO:0003702
go 1 - 518 GO:0005634
go 1 - 518 GO:0005737
go 1 - 518 GO:0006350
go 1 - 518 GO:0006917
go 1 - 518 GO:0007267
go 1 - 518 GO:0008134
go 1 - 518 GO:0010552
go 1 - 518 GO:0030336
go 1 - 518 GO:0035117
go 1 - 518 GO:0043565
go 1 - 518 GO:0051891
go 1 - 518 GO:0060039
go 1 - 518 GO:0060044
h-invdb 1 - 518 HIX0011026
hgnc 1 - 518 HGNC:11604
hogenom 1 - 518 HBG713452
hovergen 1 - 518 HBG007310
hpa 1 - 518 HPA008786
inparanoid 1 - 518 Q99593
intact 1 - 518 Q99593
interpro 1 - 518 IPR001699
interpro 1 - 518 IPR008967
interpro 1 - 518 IPR018186
ipi 1 - 518 IPI00216449
ipi 1 - 518 IPI00218492
kegg 1 - 518 hsa:6910
medline 1 - 518 20304256
medline 1 - 518 97141914
medline 1 - 518 97141915
medline 1 - 518 99178990
mim 1 - 518 142900
mim 1 - 518 601620
nextbio 1 - 518 27023
oma 1 - 518 PFYRSSY
orphanet 1 - 518 1350
orphanet 1 - 518 392
orthodb 1 - 518 EOG9HHRNH
panther 1 - 518 PTHR11267
pdb 1 - 518 2X6U
pdb 1 - 518 2X6V
pdbsum 1 - 518 2X6U
pdbsum 1 - 518 2X6V
pfam 1 - 518 PF00907
pharmgkb 1 - 518 PA36367
phosphosite 1 - 518 Q99593
phylomedb 1 - 518 Q99593
pride 1 - 518 Q99593
prints 1 - 518 PR00937
prosite 1 - 518 PS01264
prosite 1 - 518 PS01283
prosite 1 - 518 PS50252
proteinmodelportal 1 - 518 Q99593
pubmed 1 - 518 10077612
pubmed 1 - 518 10842287
pubmed 1 - 518 11183182
pubmed 1 - 518 15489334
pubmed 1 - 518 15735645
pubmed 1 - 518 8988164
pubmed 1 - 518 8988165
refseq 1 - 518 NP_000183.2
refseq 1 - 518 NP_542448.1
refseq 1 - 518 NP_542449.1
refseq 1 - 518 NP_852259.1
smart 1 - 518 SM00425
smr 1 - 518 Q99593
string 1 - 518 Q99593
supfam 1 - 518 SSF49417
ucsc 1 - 518 uc001tvo.1
ucsc 1 - 518 uc001tvr.1
unigene 1 - 518 Hs.381715
chain 1 - 518 T-box transcription factor TBX5 /FTId=PRO_0000184435.
conflict 7 - 49 GFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFT QQ -> ALAGAHLWSLTQKTCLRFEPRARSGPPASPPGRPR SRLHPA (in Ref. 1; CAA70592).
conflict 71 - 71 Missing (in Ref. 1; CAA70592)
conflict 94 - 94 L -> I (in Ref. 1; CAA70592)
conflict 122 - 122 S -> C (in Ref. 1; CAA70592)
conflict 132 - 132 P -> A (in Ref. 1; CAA70592)
conflict 418 - 460 MDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQ TS -> WTGYPTSTSPLTSPRGPWSLGWLAWQPWLPTAGRG NVPSTRPP (in Ref. 1; CAA70592).
conflict 468 - 470 RQC -> SSV (in Ref. 1; CAA70592)
conflict 494 - 518 PRTLSPHQYHSVHGVGMVPEWSDNS -> QGLYPLISTTLC TELAWCRVERQ (in Ref. 1; CAA70592).
dna_bind 58 - 238 T-box
var_seq 328 - 349 EEECSTTDHPYKKPYMETSPSE -> GECDHPWSICFLSYL FLSLGWG (in isoform Short). /FTId=VSP_006387.
var_seq 350 - 518 Missing (in isoform Short) /FTId=VSP_006388.
variant 49 - 49 Q -> K (in HOS) /FTId=VAR_015381.
variant 54 - 54 I -> T (in HOS) /FTId=VAR_015382.
variant 80 - 80 G -> R (in HOS; significant cardiac malformations but only minor skeletal abnormalities). /FTId=VAR_009701.
variant 237 - 237 R -> Q (in HOS; extensive upper limb malformations; affects transcriptional regulation of MYH6). /FTId=VAR_007456.
variant 237 - 237 R -> W (in HOS; extensive upper limb malformations). /FTId=VAR_009702.
keyword 1 - 518 3D-structure
keyword 1 - 518 Alternative splicing
keyword 1 - 518 Complete proteome
keyword 1 - 518 Developmental protein
keyword 1 - 518 Disease mutation
keyword 1 - 518 DNA-binding
keyword 1 - 518 Nucleus
keyword 1 - 518 Transcription
keyword 1 - 518 Transcription regulation
Molecular Weight 1 - 518 57711
1 hit 1 - 518 PF00907
1 hit 1 - 518 PS01264
1 hit 1 - 518 PS01283
1 hit 1 - 518 PS50252

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2014 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy