LSBio The Immunohistochemistry Antibody Company
  • Home
  • Products
    • All Antibodies
    • IHC-plus Antibodies
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Antibody Reports
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C190487 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



SERPINA1 / Alpha 1 Antitrypsin Antibodies

serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1

Gene Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Synonyms: SERPINA1 Antibody, A1A Antibody, A1AT Antibody, AAT Antibody, Alpha 1 Antitrypsin Antibody, Alpha-1 protease inhibitor Antibody, Alpha-1-antiproteinase Antibody, Alpha-1-antitrypsin Antibody, Alpha1AT Antibody, PRO2275 Antibody, Alpha-1-antitrypsin null Antibody, PI1 Antibody, Serpin A1 Antibody
Target Sequences: K02212 AAB59495.1 P01009
 SERPINA1 / Alpha 1 Antitrypsin Feature Table
Featured Image

Featured SERPINA1 / Alpha 1 Antitrypsin Antibody

LS-B1454 is a goat polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.

Publications (4)

1
Skeletal muscle lipogenic protein expression is not different between lean and obese individuals: a potential factor in ceramide accumulation. Thrush AB, Brindley DN, Chabowski A, Heigenhauser GJ, Dyck DJ. The Journal of clinical endocrinology and metabolism. 2009 94:5053-61. [PubMed:19837942]
2
Derlin-2-deficient mice reveal an essential role for protein dislocation in chondrocytes. Dougan SK, Hu CC, Paquet ME, Greenblatt MB, Kim J, Lilley BN, Watson N, Ploegh HL. Molecular and cellular biology. 2011 31:1145-59. (WB, IP; Mouse) [PubMed:21220515] [PMC:PMC3067910]
3
Dual role of ancient ubiquitous protein 1 (AUP1) in lipid droplet accumulation and endoplasmic reticulum (ER) protein quality control. Klemm EJ, Spooner E, Ploegh HL. The Journal of biological chemistry. 2011 286:37602-14. [PubMed:21857022] [PMC:PMC3199505]
4
Analysis of proteins in human gingival crevicular fluid by mass spectrometry. Kido J, Bando M, Hiroshima Y, Iwasaka H, Yamada K, Ohgami N, Nambu T, Kataoka M, Yamamoto T, Shinohara Y, Sagawa I, Nagata T. Journal of periodontal research. 2012 47:488-99. (WB; Human) [PubMed:22220998]
more

SERPINA1 / Alpha 1 Antitrypsin Antibodies (77)

Target Reactivity Applications Host Clonality Clone Format Epitope Publications
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human IHC-P, IF, WB, IP, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody IHC-plus™ LS-B1454
IHC Image
WB Image
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human IHC-P, IF, WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody IHC-plus™ LS-B421
IHC Image
WB Image
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human IHC-P, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody IHC-plus™ LS-B3128
IHC Image
IHC Image
Mouse Monoclonal (IgG2a) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 9A1 Unconjugated Human, Monkey, Dog IHC-P, WB, IP, Flo No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 9A1] IHC-plus™ LS-B10259
IHC Image
Flo Image
Mouse Monoclonal [clone 9A1] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Monkey, Dog
IHC - Paraffin, Western blot, Immunoprecipitation, Flow Cytometry
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 11G2 Unconjugated Human, Monkey, Dog IHC-P, WB, IP No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 11G2] IHC-plus™ LS-B10262
IHC Image
WB Image
Mouse Monoclonal [clone 11G2] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Monkey, Dog
IHC - Paraffin, Western blot, Immunoprecipitation
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 15H10 Unconjugated Human, Monkey, Dog IHC-P, WB, IP No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 15H10] IHC-plus™ LS-B10261
IHC Image
WB Image
Mouse Monoclonal [clone 15H10] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Monkey, Dog
IHC - Paraffin, Western blot, Immunoprecipitation
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 5B12 Unconjugated Human, Monkey, Dog IHC-P, WB, IP No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 5B12] IHC-plus™ LS-B10260
IHC Image
WB Image
Mouse Monoclonal [clone 5B12] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Monkey, Dog
IHC - Paraffin, Western blot, Immunoprecipitation
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 48D2 Unconjugated Human IHC-P, WB No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 48D2] IHC-plus™ LS-B7084
IHC Image
WB Image
Mouse Monoclonal [clone 48D2] (IgG1,k) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human IHC-P, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody IHC-plus™ LS-B9028
IHC Image
Mouse Monoclonal (IgG2a) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal F46.4.1 Unconjugated Human IHC-P, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone F46.4.1] IHC-plus™ LS-B6599
IHC Image
Mouse Monoclonal [clone F46.4.1] (IgG1,k) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Chicken Polyclonal Unconjugated Human IHC-P, WB, ELISA aa30-41 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa30-41) IHC-plus™ LS-B4240
IHC Image
Chicken Polyclonal (IgY) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human IHC-P, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody IHC-plus™ LS-B9010
IHC Image
Mouse Monoclonal (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human IHC, WB C-Terminus No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (C-Terminus) LS-C31768
IHC Image
WB Image
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC, Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human, Baboon, Monkey, Horse, Mink IHC-P No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C88736
IHC Image
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Baboon, Monkey, Horse, Mink
IHC - Paraffin
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human, Monkey, Horse IHC-P No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11911
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Monkey, Horse
IHC - Paraffin
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 5B12 Biotin Conjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 5B12] (Biotin) LS-C174954
ELISA Image
ELISA Image
Mouse Monoclonal [clone 5B12] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Biotin Conjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 8E3 Unconjugated Human IHC-P, WB, IP No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 8E3] LS-C114484
IHC Image
IHC Image
Mouse Monoclonal [clone 8E3] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, Western blot, Immunoprecipitation
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human IHC-P, IHC-Fr No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C202920
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, IHC - Frozen
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human IHC-P, IHC-Fr No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C42816
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, IHC - Frozen
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 1C2 Unconjugated Human IHC-P, ICC, IF, WB, Flo No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 1C2] LS-C114359
IF Image
IF Image
Mouse Monoclonal [clone 1C2] (IgG2b) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Paraffin, ICC, Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Biotin Conjugated Human IHC, IF, WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (Biotin) LS-C59470
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC, Immunofluorescence, Western blot, ELISA
Biotin Conjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human IHC, ICC No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C195178
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC, ICC
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human IHC No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C170854
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Biotin Conjugated Human IHC, IF, WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (Biotin) LS-C11918
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC, Immunofluorescence, Western blot, ELISA
Biotin Conjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Biotin Conjugated Human IHC, IF, WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (Biotin) LS-C11917
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC, Immunofluorescence, Western blot, ELISA
Biotin Conjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal HRP Conjugated Human IHC-Fr, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (HRP) LS-C11900
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
IHC - Frozen, ELISA
HRP Conjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human WB, IP, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C59210
WB Image
WB Image
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, Immunoprecipitation, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 3C5 Unconjugated Human WB No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 3C5] LS-C114360
WB Image
WB Image
Mouse Monoclonal [clone 3C5] (IgG2b) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 11G2 Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 11G2] LS-C174837
ELISA Image
ELISA Image
Mouse Monoclonal [clone 11G2] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human WB, ELISA aa230-241 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa230-241) LS-C204969
WB Image
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human, Chimpanzee, Gibbon, Monkey WB, ELISA aa33-45 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa33-45) LS-C204971
WB Image
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Chimpanzee, Gibbon, Monkey
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal 2B12 Unconjugated Human, Mouse WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody [clone 2B12] LS-C171464
WB Image
Mouse Monoclonal [clone 2B12] (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Mouse
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human WB, ELISA aa25-418 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa25-418) LS-C137550
WB Image
Mouse Monoclonal (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human WB aa165-195 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa165-195) LS-C168977
WB Image
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human WB C-Terminus No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (C-Terminus) LS-C116930
WB Image
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human WB C-Terminus No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (C-Terminus) LS-C178325
WB Image
Mouse Monoclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human WB, ID No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C41718
Rabbit Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, Immunodiffusion
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C85672
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal Unconjugated Human ID No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C187729
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Immunodiffusion
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ID No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C147210
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Immunodiffusion
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal HRP Conjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (HRP) LS-C42310
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
HRP Conjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C84250
Mouse Monoclonal (IgG1)
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C85976
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C85658
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C95889
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C83049
Mouse Monoclonal (IgG2a) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C83052
Mouse Monoclonal (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C83051
Mouse Monoclonal (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C83050
Mouse Monoclonal (IgG1) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C196541
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C195274
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C187805
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C195039
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C95775
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C195056
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C195040
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal Unconjugated Human ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11888
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA, Immunoelectrophoresis
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal Unconjugated Human ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11887
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA, Immunoelectrophoresis
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal HRP Conjugated Human ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (HRP) LS-C11894
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA, Immunoelectrophoresis
HRP Conjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Pig ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C184959
Goat Polyclonal (IgG) to Pig SERPINA1 / Alpha 1 Antitrypsin
Pig
ELISA, Immunoelectrophoresis
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Chicken Polyclonal Unconjugated Human, Mouse, Rat WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C69055
Chicken Polyclonal (IgY) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Mouse, Rat
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11886
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA, Immunoelectrophoresis
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11916
Mouse Monoclonal (IgG1,k) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11915
Mouse Monoclonal (IgG2a,k) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Chicken Polyclonal Unconjugated Human, Mouse, Rat WB, ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11878
Chicken Polyclonal (IgY) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Mouse, Rat
Western blot, ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA, IE No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11885
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA, Immunoelectrophoresis
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Chicken Polyclonal Biotin Conjugated Human, Mouse, Rat WB, ELISA aa1-417 No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody (aa1-417) (Biotin) LS-C11879
Chicken Polyclonal (IgY) to Human SERPINA1 / Alpha 1 Antitrypsin
Human, Mouse, Rat
Western blot, ELISA
Biotin Conjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11890
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Rabbit Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C126816
Rabbit Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Mouse Monoclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11906
Mouse Monoclonal (IgG2b) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11904
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C125086
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C126820
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human ELISA No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C126815
Goat Polyclonal to Human SERPINA1 / Alpha 1 Antitrypsin
Human
ELISA
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Sheep Polyclonal Unconjugated Human ID No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C125087
Sheep Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Immunodiffusion
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C126819
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated
SERPINA1 / Alpha 1 Antitrypsin Goat Polyclonal Unconjugated Human No
Anti-SERPINA1 / Alpha 1 Antitrypsin Antibody LS-C11889
Goat Polyclonal (IgG) to Human SERPINA1 / Alpha 1 Antitrypsin
Human
Unconjugated

SERPINA1 / Alpha 1 Antitrypsin Feature Table


Feature Type Location Details
alternative products 1 - 418 Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P01009-1; Sequence=Displayed; Name=2; IsoId=P01009-2; Sequence=VSP_028889; Note=No experimental confirmation available; Name=3; IsoId=P01009-3; Sequence=VSP_028890; Note=No experimental confirmation available;
domain 1 - 418 The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Function 1 - 418 Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.
Function 1 - 418 Short peptide from AAT (SPAAT) is a reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
interaction 1 - 418 P00760:- (xeno); NbExp=1; IntAct=EBI-986224, EBI-986385; P00772:CELA1 (xeno); NbExp=1; IntAct=EBI-986224, EBI-986248; P71213:espB (xeno); NbExp=2; IntAct=EBI-986224, EBI-2615322;
miscellaneous 1 - 418 The aberrant form is found in the plasma of chronic smokers, and persists after smoking is ceased. It can still be found ten years after smoking has ceased.
polymorphism 1 - 418 The sequence shown is that of the M1V allele which is the most common form of PI (44 to 49%). Other frequent alleles are: M1A 20 to 23%; M2 10 to 11%; M3 14 to 19%.
ptm 1 - 418 Proteolytic processing may yield the truncated form that ranges from Asp-30 to Lys-418.
ptm 1 - 418 Several isomers are observed, resulting from the combination of different N-linked glycan structures and mature N-terminus. N- linked glycan at Asn-107 is alternatively di-antennary, tri- antennary or tetra-antennary, whereas glycan at Asn-70 is di- antennary with trace amounts of tri-antennary, and glycan at Asn- 271 is exclusively di-antennary. The structure of the antennas is Neu5Ac(alpha1-6)Gal(beta1-4)GlcNAc attached to the core structure Man(alpha1-6)[Man(alpha1-3)]Man(beta1-4)GlcNAc(beta1-4)GlcNAc. Some antennas are fucosylated, which forms a Lewis-X determinant.
sequence caution 1 - 418 Sequence=CAD62334.1; Type=Erroneous initiation; Note=Translation N-terminally extended; Sequence=CAD62585.1; Type=Erroneous initiation; Note=Translation N-terminally extended;
Similarity 1 - 418 Belongs to the serpin family.
Subcellular Location 1 - 418 Secreted.
Subcellular Location 1 - 418 Short peptide from AAT: Secreted, extracellular space, extracellular matrix.
Tissue Specificity 1 - 418 Plasma.
web resource 1 - 418 Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/SERPINA1";
web resource 1 - 418 Name=Wikipedia; Note=Alpha-1 antitrypsin entry; URL="http://en.wikipedia.org/wiki/Alpha_1-antitrypsin";
arrayexpress 1 - 418 P01009
bgee 1 - 418 P01009
cornea-2dpage 1 - 418 P01009
ctd 1 - 418 5265
doi 1 - 418 10
dosac-cobs-2dpage 1 - 418 P01009
drugbank 1 - 418 DB00058
eggnog 1 - 418 prNOG09018
embl 1 - 418 AF113676
embl 1 - 418 AF130068
embl 1 - 418 AK315637
embl 1 - 418 AM048838
embl 1 - 418 BC011991
embl 1 - 418 BC015642
embl 1 - 418 BT019455
embl 1 - 418 BX161449
embl 1 - 418 BX247968
embl 1 - 418 BX248002
embl 1 - 418 BX248257
embl 1 - 418 DQ682455
embl 1 - 418 J00064
embl 1 - 418 J00065
embl 1 - 418 J00066
embl 1 - 418 J00067
embl 1 - 418 J02619
embl 1 - 418 K01396
embl 1 - 418 K02212
embl 1 - 418 M11465
embl 1 - 418 M26123
embl 1 - 418 V00496
embl 1 - 418 X01683
embl 1 - 418 X02920
ensembl 1 - 418 ENST00000355814
ensembl 1 - 418 ENST00000393087
ensembl 1 - 418 ENST00000393088
ensembl 1 - 418 ENST00000404814
ensembl 1 - 418 ENST00000426226
ensembl 1 - 418 ENST00000437074
ensembl 1 - 418 ENST00000437397
ensembl 1 - 418 ENST00000440909
ensembl 1 - 418 ENST00000448140
ensembl 1 - 418 ENST00000448921
ensembl 1 - 418 ENST00000449399
genecards 1 - 418 GC14M094843
geneid 1 - 418 5265
genevestigator 1 - 418 P01009
germonline 1 - 418 ENSG00000197249
glycosuitedb 1 - 418 P01009
go 1 - 418 GO:0002020
go 1 - 418 GO:0004867
go 1 - 418 GO:0005578
go 1 - 418 GO:0005615
go 1 - 418 GO:0006953
go 1 - 418 GO:0007596
go 1 - 418 GO:0031093
h-invdb 1 - 418 HIX0011929
hgnc 1 - 418 HGNC:8941
hovergen 1 - 418 HBG005957
hpa 1 - 418 CAB013211
hpa 1 - 418 CAB016648
hpa 1 - 418 HPA000927
hpa 1 - 418 HPA001292
inparanoid 1 - 418 P01009
intact 1 - 418 P01009
interpro 1 - 418 IPR000215
ipi 1 - 418 IPI00553177
ipi 1 - 418 IPI00790784
ipi 1 - 418 IPI00869004
kegg 1 - 418 hsa:5265
medline 1 - 418 20081076
medline 1 - 418 20178938
medline 1 - 418 20386623
medline 1 - 418 20509356
medline 1 - 418 21103710
medline 1 - 418 22336385
medline 1 - 418 22660472
medline 1 - 418 22863108
medline 1 - 418 82082539
medline 1 - 418 82220035
medline 1 - 418 82220135
medline 1 - 418 83297520
medline 1 - 418 84107980
medline 1 - 418 84292309
medline 1 - 418 85036645
medline 1 - 418 85047190
medline 1 - 418 85176977
medline 1 - 418 85225507
medline 1 - 418 86005469
medline 1 - 418 87057257
medline 1 - 418 88324438
medline 1 - 418 89008457
medline 1 - 418 89154435
medline 1 - 418 89221004
medline 1 - 418 89270478
medline 1 - 418 89352843
medline 1 - 418 90097863
medline 1 - 418 90109164
medline 1 - 418 90178096
medline 1 - 418 90196014
medline 1 - 418 90252805
medline 1 - 418 90358792
medline 1 - 418 90368097
medline 1 - 418 91033789
medline 1 - 418 91072661
medline 1 - 418 91241132
medline 1 - 418 91286296
medline 1 - 418 91310496
medline 1 - 418 91315455
medline 1 - 418 93024095
medline 1 - 418 93312288
medline 1 - 418 93372875
medline 1 - 418 95067973
medline 1 - 418 96128217
medline 1 - 418 96313123
medline 1 - 418 97094975
medline 1 - 418 98120621
medline 1 - 418 98139957
merops 1 - 418 I04.001
mim 1 - 418 107400
mint 1 - 418 MINT-365327
nextbio 1 - 418 20336
ogp 1 - 418 P01009
oma 1 - 418 PMMNRLG
orphanet 1 - 418 178396
orphanet 1 - 418 60
orthodb 1 - 418 EOG93V2F9
panther 1 - 418 PTHR11461
pathway_interaction_db 1 - 418 hnf3apathway
pdb 1 - 418 1ATU
pdb 1 - 418 1D5S
pdb 1 - 418 1EZX
pdb 1 - 418 1HP7
pdb 1 - 418 1IZ2
pdb 1 - 418 1KCT
pdb 1 - 418 1OO8
pdb 1 - 418 1OPH
pdb 1 - 418 1PSI
pdb 1 - 418 1QLP
pdb 1 - 418 1QMB
pdb 1 - 418 2D26
pdb 1 - 418 2QUG
pdb 1 - 418 3CWL
pdb 1 - 418 3CWM
pdb 1 - 418 3DRM
pdb 1 - 418 3DRU
pdb 1 - 418 7API
pdb 1 - 418 8API
pdb 1 - 418 9API
pdbsum 1 - 418 1ATU
pdbsum 1 - 418 1D5S
pdbsum 1 - 418 1EZX
pdbsum 1 - 418 1HP7
pdbsum 1 - 418 1IZ2
pdbsum 1 - 418 1KCT
pdbsum 1 - 418 1OO8
pdbsum 1 - 418 1OPH
pdbsum 1 - 418 1PSI
pdbsum 1 - 418 1QLP
pdbsum 1 - 418 1QMB
pdbsum 1 - 418 2D26
pdbsum 1 - 418 2QUG
pdbsum 1 - 418 3CWL
pdbsum 1 - 418 3CWM
pdbsum 1 - 418 3DRM
pdbsum 1 - 418 3DRU
pdbsum 1 - 418 7API
pdbsum 1 - 418 8API
pdbsum 1 - 418 9API
pfam 1 - 418 PF00079
pharmgkb 1 - 418 PA35509
phosphosite 1 - 418 P01009
phylomedb 1 - 418 P01009
pir 1 - 418 A21853
pir 1 - 418 A61391
pmap-cutdb 1 - 418 P01009
pride 1 - 418 P01009
prosite 1 - 418 PS00284
proteinmodelportal 1 - 418 P01009
pubmed 1 - 418 10612848
pubmed 1 - 418 10651487
pubmed 1 - 418 10716194
pubmed 1 - 418 10933492
pubmed 1 - 418 11057674
pubmed 1 - 418 11178897
pubmed 1 - 418 12244055
pubmed 1 - 418 12754519
pubmed 1 - 418 12860985
pubmed 1 - 418 1406456
pubmed 1 - 418 14702039
pubmed 1 - 418 14760718
pubmed 1 - 418 15084671
pubmed 1 - 418 15489334
pubmed 1 - 418 16263699
pubmed 1 - 418 16335952
pubmed 1 - 418 16622833
pubmed 1 - 418 17650587
pubmed 1 - 418 1859394
pubmed 1 - 418 1905728
pubmed 1 - 418 1906855
pubmed 1 - 418 19159218
pubmed 1 - 418 1967187
pubmed 1 - 418 19838169
pubmed 1 - 418 2035534
pubmed 1 - 418 2227940
pubmed 1 - 418 2254451
pubmed 1 - 418 2309708
pubmed 1 - 418 2316526
pubmed 1 - 418 2339709
pubmed 1 - 418 2390072
pubmed 1 - 418 2394452
pubmed 1 - 418 2606478
pubmed 1 - 418 2669992
pubmed 1 - 418 2784123
pubmed 1 - 418 2785270
pubmed 1 - 418 2786335
pubmed 1 - 418 2901226
pubmed 1 - 418 2985281
pubmed 1 - 418 3262617
pubmed 1 - 418 3491072
pubmed 1 - 418 3873938
pubmed 1 - 418 3876243
pubmed 1 - 418 6093867
pubmed 1 - 418 6319097
pubmed 1 - 418 6332197
pubmed 1 - 418 6387509
pubmed 1 - 418 6604220
pubmed 1 - 418 6979715
pubmed 1 - 418 7031661
pubmed 1 - 418 7045697
pubmed 1 - 418 7977369
pubmed 1 - 418 8323530
pubmed 1 - 418 8364590
pubmed 1 - 418 8543039
pubmed 1 - 418 8756325
pubmed 1 - 418 8939743
pubmed 1 - 418 9459000
pubmed 1 - 418 9466920
reactome 1 - 418 REACT_604
refseq 1 - 418 NP_000286.3
refseq 1 - 418 NP_001002235.1
refseq 1 - 418 NP_001002236.1
refseq 1 - 418 NP_001121172.1
refseq 1 - 418 NP_001121173.1
refseq 1 - 418 NP_001121174.1
refseq 1 - 418 NP_001121175.1
refseq 1 - 418 NP_001121176.1
refseq 1 - 418 NP_001121177.1
refseq 1 - 418 NP_001121178.1
refseq 1 - 418 NP_001121179.1
reproduction-2dpage 1 - 418 IPI00553177
reproduction-2dpage 1 - 418 P01009
siena-2dpage 1 - 418 P01009
smart 1 - 418 SM00093
string 1 - 418 P01009
supfam 1 - 418 SSF56574
swiss-2dpage 1 - 418 P01009
ucd-2dpage 1 - 418 P01009
ucsc 1 - 418 uc001ycx.2
ucsc 1 - 418 uc001yda.1
unigene 1 - 418 Hs.525557
alt_init; mrna 1 - 418 CAD62334.1
alt_init; mrna 1 - 418 CAD62585.1
joined; genomic_dna 1 - 418 AAB59370.1
carbohyd 70 - 70 N-linked (GlcNAc...) (complex)
carbohyd 107 - 107 N-linked (GlcNAc...) (complex)
carbohyd 271 - 271 N-linked (GlcNAc...) (complex)
chain 25 - 418 Alpha-1-antitrypsin /FTId=PRO_0000032377.
conflict 12 - 12 Missing (in Ref. 4; AAA51546)
conflict 23 - 23 L -> P (in Ref. 11; BAG38005)
conflict 26 - 26 D -> H (in Ref. 18; AA sequence)
conflict 39 - 39 H -> L (in Ref. 18; AA sequence)
conflict 61 - 61 L -> P (in Ref. 9; AAF29581)
conflict 96 - 96 T -> A (in Ref. 7; ABG73380)
conflict 139 - 140 GN -> DG (in Ref. 1; AAB59375)
conflict 174 - 174 T -> H (in Ref. 4; AAA51546)
conflict 229 - 229 E -> D (in Ref. 4; AAA51546)
conflict 273 - 273 T -> N (in Ref. 1; AAB59375)
conflict 280 - 280 D -> G (in Ref. 7; ABG73380)
conflict 326 - 326 V -> I (in Ref. 3; CAA25838)
conflict 410 - 410 G -> L (in Ref. 24; AA sequence)
conflict 414 - 414 N -> S (in Ref. 24; AA sequence)
Modification 256 - 256 S-cysteinyl cysteine
mutagen 382 - 382 M->V: Oxidation-resistant inhibitor of therapeutic importance.
peptide 375 - 418 Short peptide from AAT /FTId=PRO_0000364030.
region 368 - 392 RCL
site 382 - 383 Reactive bond
var_seq 307 - 418 Missing (in isoform 3) /FTId=VSP_028890.
var_seq 356 - 418 AVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVF LMIEQNTKSPLFMGKVVNPTQK -> VRSP (in isoform 2). /FTId=VSP_028889.
variant 4 - 4 S -> L (in Z-Wrexham) /FTId=VAR_006978.
variant 26 - 26 D -> A (in V-Munich) /FTId=VAR_006979.
variant 37 - 37 T -> A (in dbSNP:rs11558262) /FTId=VAR_051938.
variant 58 - 58 A -> T (in M5-Karlsruhe) /FTId=VAR_006980.
variant 63 - 63 R -> C (in I; dbSNP:rs28931570) /FTId=VAR_006981.
variant 65 - 65 L -> P (in M-Procida; dbSNP:rs28931569) /FTId=VAR_006982.
variant 69 - 69 S -> F (in M6-Bonn) /FTId=VAR_006983.
variant 75 - 75 Missing (in M-Malton, M-Nichinan and M- Palermo; associated with very low serum levels of AAT; homozygosity for allele M- Malton may be associated with a risk for chronic emphysema or infantile liver cirrhosis). /FTId=VAR_006984.
variant 77 - 77 S -> F (in S-Iiyama; dbSNP:rs55819880) /FTId=VAR_006985.
variant 84 - 84 A -> T (in M6-Passau) /FTId=VAR_006986.
variant 91 - 91 G -> E (in M-Mineral springs; causes reduced AAT secretion; dbSNP:rs28931568). /FTId=VAR_006987.
variant 92 - 92 T -> I (in QO-Lisbon; deficient AAT with very low serum levels). /FTId=VAR_006988.
variant 109 - 109 T -> M (in Z-Bristol; deficient AA; disrupts the N-glycosylation site N-107). /FTId=VAR_011620.
variant 112 - 112 P -> T (in M5-Berlin) /FTId=VAR_006989.
variant 116 - 116 I -> N (in QO-Ludwigshafen; dbSNP:rs28931572). /FTId=VAR_006990.
variant 125 - 125 R -> H (in M2; associated with D-400; dbSNP:rs709932). /FTId=VAR_006991.
variant 139 - 139 G -> S (in QO-Newport; dbSNP:rs11558261) /FTId=VAR_006992.
variant 172 - 172 G -> R (in V and M-Nichinan) /FTId=VAR_006993.
variant 172 - 172 G -> W (in M2-Obernburg) /FTId=VAR_006994.
variant 180 - 180 Q -> E (in L-Frankfurt) /FTId=VAR_006995.
variant 190 - 198 QGKIVDLVK -> GFQNAILVR (in Aberrant form). /FTId=VAR_036746.
variant 228 - 228 E -> K (in X) /FTId=VAR_006996.
variant 237 - 237 V -> A (in M1A and Z; associated with K- 366 in Z; dbSNP:rs6647). /FTId=VAR_006997.
variant 247 - 247 R -> C (in F; dbSNP:rs28929470) /FTId=VAR_006998.
variant 280 - 280 D -> V (in P-Duarte/P-Cardiff/P-Lowell; associated with H-415 in Y-Barcelona; dbSNP:rs28929472). /FTId=VAR_006999.
variant 288 - 288 E -> V (in S and T; dbSNP:rs17580) /FTId=VAR_007000.
variant 305 - 305 Missing (in Basque) /FTId=VAR_009216.
variant 354 - 354 S -> F (in S-Munich) /FTId=VAR_007001.
variant 360 - 360 A -> T (in W-Bethesda; dbSNP:rs1802959) /FTId=VAR_007002.
variant 365 - 365 D -> N (in P-St.Albans/P-Donauwoerth) /FTId=VAR_007003.
variant 366 - 366 E -> K (in Z/Z-Augsburg/Z-Tun; associated with A-237 in Z; dbSNP:rs28929474). /FTId=VAR_007004.
variant 382 - 382 M -> R (in Pittsburgh; has antithrombin activity; causes fatal bleeding diathesis). /FTId=VAR_007005.
variant 386 - 386 P -> H (in Sao Tome) /FTId=VAR_007006.
variant 386 - 386 P -> T (in L-Offenbach) /FTId=VAR_007007.
variant 387 - 387 E -> K (in Christchurch) /FTId=VAR_007008.
variant 393 - 393 P -> L (in M-Heerlen) /FTId=VAR_007009.
variant 400 - 400 E -> D (in M2 and M3; associated with H- 125 in M2; dbSNP:rs1303). /FTId=VAR_007010.
variant 415 - 415 P -> H (in Y-Barcelona; associated with V-280). /FTId=VAR_007011.
keyword 1 - 418 3D-structure
keyword 1 - 418 Acute phase
keyword 1 - 418 Alternative splicing
keyword 1 - 418 Blood coagulation
keyword 1 - 418 Complete proteome
keyword 1 - 418 Direct protein sequencing
keyword 1 - 418 Extracellular matrix
keyword 1 - 418 Glycoprotein
keyword 1 - 418 Polymorphism
keyword 1 - 418 Protease inhibitor
keyword 1 - 418 Secreted
keyword 1 - 418 Serine protease inhibitor
keyword 1 - 418 Signal
Molecular Weight 1 - 418 46737
1 hit 1 - 418 PF00079
1 hit 1 - 418 PS00284

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).

Copyright © 2014 LifeSpan BioSciences, Inc. All Rights Reserved