LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • DNA-Binding ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Antibody Reports
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C48032 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



PSEN1 / Presenilin 1 Antibodies

presenilin 1

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined.

Gene Name: presenilin 1
Family/Subfamily: protease , Aspartic A22A
Synonyms: PSEN1 Antibody, AD3 Antibody, Alzheimer disease 3 Antibody, FAD Antibody, Protein S182 Antibody, PS1 Antibody, S182 Antibody, PS-1 Antibody, PSNL1 Antibody, Presenilin 1 Antibody, Presenilin-1 Antibody
Target Sequences: NM_000021 NP_000012.1 P49768
 PSEN1 / Presenilin 1 Feature Table
Featured Image

Featured PSEN1 / Presenilin 1 Antibody

LS-B6832 is a rabbit polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.


PSEN1 / Presenilin 1 Antibodies (48)

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Dog, Guinea pig, Hamster, Pig IHC-P, WB aa107-156 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa107-156) IHC-plus™ LS-B6832
IHC Image
WB Image
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bat, Dog, Guinea pig, Hamster, Pig
IHC - Paraffin, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC-P, WB C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus) IHC-plus™ LS-B1390
IHC Image
IF Image
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC - Paraffin, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bovine, Guinea pig, Horse, Pig IHC-P, WB aa300-349 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa300-349) IHC-plus™ LS-B6952
IHC Image
WB Image
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Bovine, Guinea pig, Horse, Pig
IHC - Paraffin, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat, Xenopus WB, ELISA No Primary
Anti-PSEN1 / Presenilin 1 Antibody LS-C26137
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat, Xenopus
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Mouse IHC-P, IF, WB, Flo C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus) LS-C100478
IHC Image
IF Image
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Mouse
IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Monoclonal EP2000Y Unconjugated Human, Mouse, Rat IHC-P, ICC, WB, IP, Flo Internal No Primary
Anti-PSEN1 / Presenilin 1 Antibody (Internal, clone EP2000Y) LS-C50044
IHC Image
WB Image
Rabbit Monoclonal [clone EP2000Y] (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC - Paraffin, ICC, Western blot, Immunoprecipitation, Flow Cytometry
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC, WB, ELISA pSer357 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (phospho-Ser357) LS-C199498
WB Image
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Mouse, Rat IHC, WB, ELISA aa323-372 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa323-372) LS-C199497
WB Image
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human IHC-P, WB, ELISA aa1-50 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa1-50) LS-C118561
WB Image
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
IHC - Paraffin, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human IHC, WB Ser28 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (Ser28) LS-C176185
IHC Image
WB Image
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human
IHC, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Mouse, Rat IHC-P N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C50614
IHC Image
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC - Paraffin
Unconjugated
PSEN1 / Presenilin 1 Goat IgG Polyclonal Unconjugated Human IHC-P, IHC-Fr, WB, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C3071
Goat Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
IHC - Paraffin, IHC - Frozen, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Goat IgG Polyclonal Unconjugated Human IHC-P, IHC-Fr, WB, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C26124
Goat Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
IHC - Paraffin, IHC - Frozen, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human IHC, WB, IP, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C48030
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human
IHC, Western blot, Immunoprecipitation, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rat IgG1 Monoclonal 24-4B5 Unconjugated Human, Mouse, Rat IHC, WB No Primary
Anti-PSEN1 / Presenilin 1 Antibody (clone 24-4B5) LS-C180188
Rat Monoclonal [clone 24-4B5] (IgG1)
Human, Mouse, Rat
IHC, Western blot
Unconjugated
PSEN1 / Presenilin 1 Mouse IgG1 Monoclonal 17C2 Unconjugated Human IHC, WB N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus, clone 17C2) LS-C193603
Mouse Monoclonal [clone 17C2] (IgG1) to Human PSEN1 / Presenilin 1
Human
IHC, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Monkey, Hamster IHC-Fr N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C42920
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Monkey, Hamster
IHC - Frozen
Unconjugated
PSEN1 / Presenilin 1 Mouse IgG1 Monoclonal 34-4C3 Unconjugated Human, Mouse, Rat, Primate IHC-Fr No Primary
Anti-PSEN1 / Presenilin 1 Antibody (clone 34-4C3) LS-C180187
Mouse Monoclonal [clone 34-4C3] (IgG1)
Human, Mouse, Rat, Primate
IHC - Frozen
Unconjugated
PSEN1 / Presenilin 1 Mouse IgG1 Monoclonal Unconjugated Human, Mouse, Rat IHC-P, ICC, WB, IP, ELISA aa263-378 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa263-378) LS-C26120
Mouse Monoclonal (IgG1) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC - Paraffin, ICC, Western blot, Immunoprecipitation, ELISA
Unconjugated
PSEN1 / Presenilin 1 Mouse IgG1 Monoclonal Unconjugated Human, Orangutan, Gibbon, Monkey IHC-P, IF, WB, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C92294
Mouse Monoclonal (IgG1) to Human PSEN1 / Presenilin 1
Human, Orangutan, Gibbon, Monkey
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rat IgG Monoclonal Unconjugated Human IHC, WB, IP, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C26136
Rat Monoclonal (IgG) to Human PSEN1 / Presenilin 1
Human
IHC, Western blot, Immunoprecipitation, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal FITC Conjugated Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, FITC) LS-C281154
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
FITC Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Biotin Conjugated Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, Biotin) LS-C281153
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
Biotin Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal PE Conjugated Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, PE) LS-C281156
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
PE Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal HRP Conjugated, Azide-free Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, Azide-free, HRP) LS-C281155
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
HRP Conjugated, Azide-free
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Monkey IHC-Fr, WB, IP No Primary
Anti-PSEN1 / Presenilin 1 Antibody LS-C26121
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Monkey
IHC - Frozen, Western blot, Immunoprecipitation
Unconjugated
PSEN1 / Presenilin 1 Chicken IgY Polyclonal Unconjugated Human, Mouse, Rat IHC, WB, ELISA No Primary
Anti-PSEN1 / Presenilin 1 Antibody LS-C26127
Chicken Polyclonal (IgY) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
IHC, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal AP Conjugated Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, AP) LS-C281152
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
AP Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal APC Conjugated Human, Mouse IHC, WB, ELISA C-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (C-Terminus, APC) LS-C281151
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse
IHC, Western blot, ELISA
APC Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Monkey, Hamster IHC-Fr N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C26132
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Monkey, Hamster
IHC - Frozen
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Monkey, Hamster IHC-Fr N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C92295
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Monkey, Hamster
IHC - Frozen
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human IHC aa431-467 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa431-467) LS-C191215
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
IHC
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Monoclonal EP2001Y Unconjugated Human ICC, WB pSer310 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (phospho-Ser310, clone EP2001Y) LS-C105338
WB Image
Rabbit Monoclonal [clone EP2001Y] (IgG) to Human PSEN1 / Presenilin 1
Human
ICC, Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Monoclonal EP1998Y Unconjugated Human, Mouse, Rat WB, Flo NTF Subunit No Primary
Anti-PSEN1 / Presenilin 1 Antibody (NTF Subunit, clone EP1998Y) LS-C50102
WB Image
Rabbit Monoclonal [clone EP1998Y] (IgG)
Human, Mouse, Rat
Western blot, Flow Cytometry
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Orangutan, Gibbon, Monkey WB, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C51632
WB Image
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Orangutan, Gibbon, Monkey
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Goat Polyclonal Unconjugated Human WB, ELISA aa14-33 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa14-33) LS-C85931
Goat Polyclonal to Human PSEN1 / Presenilin 1
Human
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Mouse, Rat WB No Primary
Anti-PSEN1 / Presenilin 1 Antibody LS-C48462
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
Western blot
Unconjugated
PSEN1 / Presenilin 1 Rabbit Polyclonal Unconjugated Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster ELISA aa345-359 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa345-359) LS-C3161
Rabbit Polyclonal to Human PSEN1 / Presenilin 1
Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster
ELISA
Unconjugated
PSEN1 / Presenilin 1 Goat IgG Polyclonal Unconjugated Human aa14-33 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa14-33) LS-C195745
Goat Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
Unconjugated
PSEN1 / Presenilin 1 Mouse IgG1 Monoclonal Unconjugated Human, Gorilla, Orangutan, Gibbon ICC, WB, ELISA aa313-334 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa313-334) LS-C26130
Mouse Monoclonal (IgG1) to Human PSEN1 / Presenilin 1
Human, Gorilla, Orangutan, Gibbon
ICC, Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human, Monkey, Mouse, Hamster ICC, WB, IP aa275-367 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa275-367) LS-C26122
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Monkey, Mouse, Hamster
ICC, Western blot, Immunoprecipitation
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human WB, IP, ELISA Val293 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (Val293) LS-C26126
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
Western blot, Immunoprecipitation, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rat IgG Monoclonal Unconjugated Human, Mouse, Rat WB, ELISA aa21-80 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa21-80) LS-C26139
Rat Monoclonal (IgG) to Human PSEN1 / Presenilin 1
Human, Mouse, Rat
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human WB, IP No Primary
Anti-PSEN1 / Presenilin 1 Antibody LS-C75040
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
Western blot, Immunoprecipitation
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human WB, ELISA aa1-79 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa1-79) LS-C26123
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Goat IgG Polyclonal Unconjugated Human WB, ELISA N-Terminus No Primary
Anti-PSEN1 / Presenilin 1 Antibody (N-Terminus) LS-C26135
Goat Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
Western blot, ELISA
Unconjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal CF Conjugated Human ELISA aa431-467 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa431-467, CF) LS-C184089
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
ELISA
CF Conjugated
PSEN1 / Presenilin 1 Rabbit IgG Polyclonal Unconjugated Human ELISA aa431-467 No Primary
Anti-PSEN1 / Presenilin 1 Antibody (aa431-467) LS-C191216
Rabbit Polyclonal (IgG) to Human PSEN1 / Presenilin 1
Human
ELISA
Unconjugated

PSEN1 / Presenilin 1 Feature Table


Feature Type Location Details
alternative products 1 - 467 Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=I-467; IsoId=P49768-1; Sequence=Displayed; Name=2; Synonyms=I-463; IsoId=P49768-2; Sequence=VSP_005191; Name=3; Synonyms=I-374; IsoId=P49768-3; Sequence=VSP_005191, VSP_005192; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay; Name=4; Synonyms=Minilin; IsoId=P49768-4; Sequence=VSP_007986, VSP_007987; Name=5; IsoId=P49768-5; Sequence=VSP_005192; Name=6; IsoId=P49768-6; Sequence=VSP_012288;
Disease 1 - 467 Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3) [MIM:607822]. AD3 is a familial early-onset form of Alzheimer disease. Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C- terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death.
Disease 1 - 467 Defects in PSEN1 are a cause of frontotemporal dementia [MIM:600274].
domain 1 - 467 The PAL motif is required for normal active site conformation.
Function 1 - 467 Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. Stimulates cell-cell adhesion though its association with the E-cadherin/catenin complex. Under conditions of apoptosis or calcium influx, cleaves E-cadherin promoting the disassembly of the E-cadherin/catenin complex and increasing the pool of cytoplasmic beta-catenin, thus negatively regulating Wnt signaling. May also play a role in hematopoiesis.
interaction 1 - 467 P05067:APP; NbExp=3; IntAct=EBI-297277, EBI-77613; P35222:CTNNB1; NbExp=2; IntAct=EBI-297277, EBI-491549; Q02248:Ctnnb1 (xeno); NbExp=1; IntAct=EBI-297277, EBI-397872; P14923:JUP; NbExp=3; IntAct=EBI-297277, EBI-702484; Q9NZJ7:MTCH1; NbExp=1; IntAct=EBI-297277, EBI-297455; P49755:TMED10; NbExp=2; IntAct=EBI-297277, EBI-998422;
ptm 1 - 467 After endoproteolysis, the C-terminal fragment (CTF) is phosphorylated on serine residues by PKA and/or PKC. Phosphorylation on Ser-346 inhibits endoproteolysis.
ptm 1 - 467 Heterogeneous proteolytic processing generates N-terminal (NTF) and C-terminal (CTF) fragments of approximately 35 and 20 kDa, respectively. During apoptosis, the C-terminal fragment (CTF) is further cleaved by caspase-3 to produce the fragment, PS1- CTF12.
Similarity 1 - 467 Belongs to the peptidase A22A family.
Subcellular Location 1 - 467 Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell surface. Note=Bound to NOTCH1 also at the cell surface. Colocalizes with CDH1/2 at sites of cell-cell contact. Colocalizes with CTNNB1 in the endoplasmic reticulum and the proximity of the plasma membrane. Also present in azurophil granules of neutrophils.
Subunit 1 - 467 Homodimer. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity. Other components which are associated with the complex include SLC25A64, SLC5A7, PHB and PSEN1 isoform 3. Predominantly heterodimer of a N-terminal (NTF) and a C-terminal (CTF) endoproteolytical fragment. Associates with proteolytic processed C-terminal fragments C83 and C99 of the amyloid precursor protein (APP). Associates with NOTCH1. Associates with cadherin/catenin adhesion complexes through direct binding to CDH1 or CDH2. Interaction with CDH1 stabilizes the complex and stimulates cell-cell aggregation. Interaction with CDH2 is essential for trafficking of CDH2 from the endoplasmic reticulum to the plasma membrane. Interacts with CTNND2, CTNNB1, HERP
Tissue Specificity 1 - 467 Expressed in a wide range of tissues including various regions of the brain, liver, spleen and lymph nodes.
web resource 1 - 467 Name=Alzheimer Research Forum; Note=Presenilins mutations; URL="http://www.alzforum.org/res/com/mut/pre/default.asp";
web resource 1 - 467 Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/PSEN1";
arrayexpress 1 - 467 P49768
bgee 1 - 467 P49768
cleanex 1 - 467 HS_PSEN1
ctd 1 - 467 5663
dip 1 - 467 DIP-1134N
doi 1 - 467 10
eggnog 1 - 467 prNOG04687
embl 1 - 467 AC004858
embl 1 - 467 AF109907
embl 1 - 467 AF416717
embl 1 - 467 AJ008005
embl 1 - 467 AK312531
embl 1 - 467 BC011729
embl 1 - 467 CH471061
embl 1 - 467 D84149
embl 1 - 467 L42110
embl 1 - 467 L76517
embl 1 - 467 L76519
embl 1 - 467 L76520
embl 1 - 467 L76521
embl 1 - 467 L76522
embl 1 - 467 L76523
embl 1 - 467 L76524
embl 1 - 467 L76525
embl 1 - 467 L76526
embl 1 - 467 L76527
embl 1 - 467 L76528
embl 1 - 467 U40379
embl 1 - 467 U40380
ensembl 1 - 467 ENST00000324501
genecards 1 - 467 GC14P073603
geneid 1 - 467 5663
genevestigator 1 - 467 P49768
germonline 1 - 467 ENSG00000080815
go 1 - 467 GO:0000139
go 1 - 467 GO:0000776
go 1 - 467 GO:0004175
go 1 - 467 GO:0005639
go 1 - 467 GO:0005640
go 1 - 467 GO:0005789
go 1 - 467 GO:0005887
go 1 - 467 GO:0006509
go 1 - 467 GO:0006916
go 1 - 467 GO:0007059
go 1 - 467 GO:0007220
go 1 - 467 GO:0008013
go 1 - 467 GO:0008624
go 1 - 467 GO:0009986
go 1 - 467 GO:0016337
go 1 - 467 GO:0030165
go 1 - 467 GO:0031293
go 1 - 467 GO:0042987
hgnc 1 - 467 HGNC:9508
hovergen 1 - 467 HBG011375
hpa 1 - 467 CAB006844
inparanoid 1 - 467 P49768
intact 1 - 467 P49768
interpro 1 - 467 IPR001108
interpro 1 - 467 IPR002031
interpro 1 - 467 IPR006639
ipi 1 - 467 IPI00028077
ipi 1 - 467 IPI00068752
ipi 1 - 467 IPI00219934
ipi 1 - 467 IPI00289615
ipi 1 - 467 IPI00337671
ipi 1 - 467 IPI00514137
kegg 1 - 467 hsa:5663
medline 1 - 467 20004544
medline 1 - 467 20014554
medline 1 - 467 20020213
medline 1 - 467 20062913
medline 1 - 467 20100613
medline 1 - 467 20112947
medline 1 - 467 20283925
medline 1 - 467 20359495
medline 1 - 467 20483711
medline 1 - 467 20547750
medline 1 - 467 21568415
medline 1 - 467 21916158
medline 1 - 467 21935327
medline 1 - 467 22056056
medline 1 - 467 22162526
medline 1 - 467 22369506
medline 1 - 467 22459283
medline 1 - 467 22486656
medline 1 - 467 22610381
medline 1 - 467 22656901
medline 1 - 467 95319502
medline 1 - 467 95379971
medline 1 - 467 96024664
medline 1 - 467 96160372
medline 1 - 467 96177673
medline 1 - 467 96177674
medline 1 - 467 96193901
medline 1 - 467 96310408
medline 1 - 467 97029239
medline 1 - 467 97223465
medline 1 - 467 97316242
medline 1 - 467 97317150
medline 1 - 467 97369208
medline 1 - 467 97442268
medline 1 - 467 98046005
medline 1 - 467 98099802
medline 1 - 467 98167376
medline 1 - 467 98180715
medline 1 - 467 98180720
medline 1 - 467 98383881
medline 1 - 467 99047368
medline 1 - 467 99050262
medline 1 - 467 99066768
medline 1 - 467 99066775
medline 1 - 467 99115106
medline 1 - 467 99148656
medline 1 - 467 99155075
medline 1 - 467 99188890
medline 1 - 467 99211215
medline 1 - 467 99221485
medline 1 - 467 99223278
medline 1 - 467 99368299
medline 1 - 467 99374935
medline 1 - 467 99375018
merops 1 - 467 A22.001
mim 1 - 467 104311
mim 1 - 467 600274
mim 1 - 467 607822
mint 1 - 467 MINT-88325
nextbio 1 - 467 22006
oma 1 - 467 KNSNYNA
orphanet 1 - 467 1020
orphanet 1 - 467 154
orphanet 1 - 467 282
orphanet 1 - 467 2883
orphanet 1 - 467 36385
panther 1 - 467 PTHR10202
panther 1 - 467 PTHR10202:SF7
pathway_interaction_db 1 - 467 p75ntrpathway
pathway_interaction_db 1 - 467 ps1pathway
pathway_interaction_db 1 - 467 syndecan_3_pathway
pdb 1 - 467 2KR6
pdbsum 1 - 467 2KR6
pfam 1 - 467 PF01080
pharmgkb 1 - 467 PA33855
phosphosite 1 - 467 P49768
phylomedb 1 - 467 P49768
pir 1 - 467 S58396
pir 1 - 467 S63683
pir 1 - 467 S63684
pmap-cutdb 1 - 467 P49768
pride 1 - 467 P49768
prints 1 - 467 PR01072
prints 1 - 467 PR01073
proteinmodelportal 1 - 467 P49768
pubmed 1 - 467 10025789
pubmed 1 - 467 10037471
pubmed 1 - 467 10090481
pubmed 1 - 467 10200054
pubmed 1 - 467 10206644
pubmed 1 - 467 10208579
pubmed 1 - 467 10439444
pubmed 1 - 467 10441572
pubmed 1 - 467 10447269
pubmed 1 - 467 10533070
pubmed 1 - 467 10545183
pubmed 1 - 467 10551805
pubmed 1 - 467 10593990
pubmed 1 - 467 10631141
pubmed 1 - 467 10644793
pubmed 1 - 467 10811883
pubmed 1 - 467 10899933
pubmed 1 - 467 11027672
pubmed 1 - 467 11094121
pubmed 1 - 467 11226248
pubmed 1 - 467 11710891
pubmed 1 - 467 11799129
pubmed 1 - 467 11920851
pubmed 1 - 467 11987239
pubmed 1 - 467 12048239
pubmed 1 - 467 12058025
pubmed 1 - 467 12484344
pubmed 1 - 467 12493737
pubmed 1 - 467 12508121
pubmed 1 - 467 12679784
pubmed 1 - 467 12740439
pubmed 1 - 467 14515347
pubmed 1 - 467 14576165
pubmed 1 - 467 14702039
pubmed 1 - 467 14759258
pubmed 1 - 467 15274632
pubmed 1 - 467 15341515
pubmed 1 - 467 15489334
pubmed 1 - 467 16126725
pubmed 1 - 467 16305624
pubmed 1 - 467 17081983
pubmed 1 - 467 18485326
pubmed 1 - 467 18691976
pubmed 1 - 467 19690332
pubmed 1 - 467 7550356
pubmed 1 - 467 7596406
pubmed 1 - 467 7651536
pubmed 1 - 467 8574969
pubmed 1 - 467 8634711
pubmed 1 - 467 8634712
pubmed 1 - 467 8641442
pubmed 1 - 467 8733303
pubmed 1 - 467 8804415
pubmed 1 - 467 8875251
pubmed 1 - 467 9070286
pubmed 1 - 467 9144240
pubmed 1 - 467 9172170
pubmed 1 - 467 9173929
pubmed 1 - 467 9225696
pubmed 1 - 467 9298817
pubmed 1 - 467 9384602
pubmed 1 - 467 9437013
pubmed 1 - 467 9485372
pubmed 1 - 467 9507958
pubmed 1 - 467 9521418
pubmed 1 - 467 9521423
pubmed 1 - 467 9719376
pubmed 1 - 467 9738936
pubmed 1 - 467 9831473
pubmed 1 - 467 9833068
pubmed 1 - 467 9851443
pubmed 1 - 467 9851450
pubmed 1 - 467 9915968
reactome 1 - 467 REACT_11061
reactome 1 - 467 REACT_299
refseq 1 - 467 NP_000012.1
refseq 1 - 467 NP_015557.2
smart 1 - 467 SM00730
string 1 - 467 P49768
tcdb 1 - 467 1.A.54.1.1
ucsc 1 - 467 uc001xnq.2
ucsc 1 - 467 uc001xnr.1
ucsc 1 - 467 uc001xns.1
unigene 1 - 467 Hs.3260
joined; genomic_dna 1 - 467 AAB46371.1
act_site 257 - 257 Probable
act_site 385 - 385 Probable
chain 1 - 298 Presenilin-1 NTF subunit /FTId=PRO_0000025591.
chain 299 - 467 Presenilin-1 CTF subunit /FTId=PRO_0000025592.
chain 346 - 467 Presenilin-1 CTF12 /FTId=PRO_0000236055.
compbias 94 - 97 Poly-Val
compbias 171 - 174 Poly-Leu
compbias 418 - 425 Poly-Leu
conflict 128 - 128 R -> G (in Ref. 7; AAL16811)
Modification 43 - 43 Phosphoserine
Modification 310 - 310 Phosphoserine; by PKA
Modification 346 - 346 Phosphoserine; by PKC
Modification 365 - 365 Phosphoserine
Modification 367 - 367 Phosphoserine
motif 433 - 435 PAL
mutagen 66 - 72 Missing: No effect on interaction with GFAP.
mutagen 76 - 77 KY->AA: No effect on interaction with GFAP.
mutagen 82 - 82 V->K,E: Loss of interaction with GFAP
mutagen 82 - 83 VI->EE: Loss of interaction with GFAP
mutagen 84 - 85 ML->EE: Loss of interaction with GFAP
mutagen 256 - 256 Y->F: Alters gamma-secretase cleavage specificity. Increased production of amyloid beta(42). No effect on enzymatic activity.
mutagen 257 - 257 D->A: Loss of endoproteolytic cleavage; reduces production of amyloid beta in APP processing and of NICD in NOTCH1 processing.
mutagen 257 - 257 D->E: Abolishes gamma-secretase activity Reduces production of amyloid beta in APP processing. Accumulation of full-length PS1. Loss of binding of transition state analog gamma-secretase inhibitor.
mutagen 286 - 286 L->A,E,P,Q,R,W: Increases production of amyloid beta in APP processing.
mutagen 286 - 286 L->E,R: Reduces production of NICD in NOTCH1 processing.
mutagen 292 - 292 M->D: Loss of endoproteolytic cleavage
mutagen 310 - 310 S->A: Abolishes PKA-mediated phosphorylation; no effect on caspase- mediated cleavage.
mutagen 345 - 345 D->N: Abolishes caspase cleavage
mutagen 346 - 346 S->A: Abolishes PKC-mediated phosphorylation; no effect on PKA- mediated phosphorylation.
mutagen 346 - 346 S->E: Inhibits caspase-mediated cleavage Modulates progression of apoptosis.
mutagen 373 - 373 D->N: No effect on caspase cleavage
mutagen 385 - 385 D->A: Loss of endoproteolytic cleavage Reduces production of amyloid beta in APP processing. Disassembly of the N- cadherin/PS1 complex at the cell surface. Impairs CDH2 processing.
mutagen 385 - 385 D->E: Abolishes gamma-secretase activity Reduces production of amyloid beta in APP processing. Accumulation of full-length PS1. Loss of binding of transition state analog gamma-secretase inhibitor.
mutagen 385 - 385 D->N: No effect on caspase cleavage
mutagen 389 - 389 Y->F: Alters gamma-secretase cleavage specificity. Increased production of amyloid beta(42). No effect on enzymatic activity.
mutagen 433 - 433 P->A: No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing. Slightly increased Abeta42/Abeta40 ratio.
mutagen 433 - 433 P->D,F,L,N,V: No endoproteolytic cleavage; no APP nor NOTCH1 processing. No detectable Abetano detectable Abeta.
mutagen 433 - 433 P->G: Very little endoproteolysis. Little APP processing. No NOTCH1 processing. Very low levels Abeta40 and no detectable Abeta42.
mutagen 434 - 434 A->C: Some loss of endoproteolytic cleavage. Some loss of APP and NOTCH1 processing. Six-fold increase in Abeta42/Abeta40 ratio.
mutagen 434 - 434 A->D,I,L,V: No endoproteolytic cleavage No APP nor NOTCH1 processing. No detectable Abeta.
mutagen 434 - 434 A->G: No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing. Reduced Abeta42/Abeta40 ratio.
mutagen 435 - 435 L->A: No effect on endoproteolytic cleavage. No effect on APP processing. Impaired NOTCH1 processing. Greatly reduced Abeta42/Abeta40 ratio.
mutagen 435 - 435 L->F: No endoproteolytic cleavage. No APP nor NOTCH1 processing. No detectable Abeta.
mutagen 435 - 435 L->G: Greatly reduced endoproteolytic cleavage. Very little APP and NOTCH1 processing. Very low levels of Abeta40 and no detectable Abeta42.
mutagen 435 - 435 L->I: No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing.
mutagen 435 - 435 L->V: No effect on endoproteolytic cleavage. No effect on APP processing. Impaired NOTCH1 processing. Some increase in Abeta42/Abeta40 ratio.
region 322 - 450 Required for interaction with CTNNB1
region 372 - 399 Required for interaction with CTNND2
region 464 - 467 Interaction with MTCH1
site 291 - 292 Cleavage; alternate
site 292 - 293 Cleavage; alternate
site 298 - 299 Cleavage
site 345 - 346 Cleavage; by caspase
topo_dom 1 - 82 Cytoplasmic (Potential)
topo_dom 104 - 132 Lumenal (Potential)
topo_dom 154 - 160 Cytoplasmic (Potential)
topo_dom 182 - 190 Lumenal (Potential)
topo_dom 212 - 220 Cytoplasmic (Potential)
topo_dom 242 - 243 Lumenal (Potential)
topo_dom 265 - 407 Cytoplasmic (Potential)
topo_dom 454 - 467 Cytoplasmic (Potential)
transmem 83 - 103 Helical; (Potential)
transmem 133 - 153 Helical; (Potential)
transmem 161 - 181 Helical; (Potential)
transmem 191 - 211 Helical; (Potential)
transmem 221 - 241 Helical; (Potential)
transmem 244 - 264 Helical; (Potential)
transmem 408 - 428 Helical; (Potential)
transmem 433 - 453 Helical; (Potential)
var_seq 26 - 29 Missing (in isoform 2 and isoform 3) /FTId=VSP_005191.
var_seq 162 - 184 IHAWLIISSLLLLFFFSFIYLGE -> SMRHRSLLSTLFFL WLGILVTVT (in isoform 4). /FTId=VSP_007986.
var_seq 185 - 467 Missing (in isoform 4) /FTId=VSP_007987.
var_seq 319 - 376 Missing (in isoform 6) /FTId=VSP_012288.
var_seq 319 - 467 STERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRA AVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITF GLVFYFATDYLVQPFMDQLAFHQFYI -> RACLPPAAINL LSIAPMAPRLFMPKGACRPTAQKGSHKTLLQRMMMAGSVRN GKPRGTVI (in isoform 3 and isoform 5). /FTId=VSP_005192.
variant 79 - 79 A -> V (in AD3; no effect on interaction with GFAP). /FTId=VAR_006413.
variant 82 - 82 V -> L (in AD3; no effect on interaction with GFAP). /FTId=VAR_006414.
variant 92 - 92 C -> S (in AD3) /FTId=VAR_016214.
variant 96 - 96 V -> F (in AD3) /FTId=VAR_006415.
variant 105 - 105 F -> L (in AD3) /FTId=VAR_009208.
variant 113 - 113 L -> P (in frontotemporal dementia) /FTId=VAR_016215.
variant 115 - 115 Y -> C (in AD3) /FTId=VAR_006416.
variant 115 - 115 Y -> H (in AD3) /FTId=VAR_006417.
variant 116 - 116 T -> N (in AD3) /FTId=VAR_010120.
variant 117 - 117 P -> L (in AD3) /FTId=VAR_009209.
variant 120 - 120 E -> D (in AD3) /FTId=VAR_006418.
variant 120 - 120 E -> K (in AD3) /FTId=VAR_006419.
variant 135 - 135 N -> D (in AD3) /FTId=VAR_010121.
variant 139 - 139 M -> I (in AD3) /FTId=VAR_006420.
variant 139 - 139 M -> K (in AD3) /FTId=VAR_010122.
variant 139 - 139 M -> T (in AD3) /FTId=VAR_006421.
variant 139 - 139 M -> V (in AD3) /FTId=VAR_006422.
variant 143 - 143 I -> F (in AD3) /FTId=VAR_006423.
variant 143 - 143 I -> T (in AD3) /FTId=VAR_006424.
variant 146 - 146 M -> I (in AD3) /FTId=VAR_006425.
variant 146 - 146 M -> L (in AD3) /FTId=VAR_006426.
variant 146 - 146 M -> V (in AD3) /FTId=VAR_006427.
variant 147 - 147 T -> I (in AD3) /FTId=VAR_010123.
variant 163 - 163 H -> R (in AD3) /FTId=VAR_006428.
variant 163 - 163 H -> Y (in AD3) /FTId=VAR_006429.
variant 165 - 165 W -> C (in AD3) /FTId=VAR_010124.
variant 166 - 166 L -> P (in AD3; onset in adolescence) /FTId=VAR_016216.
variant 169 - 169 S -> L (in AD3) /FTId=VAR_006430.
variant 169 - 169 S -> P (in AD3) /FTId=VAR_006431.
variant 171 - 171 L -> P (in AD3) /FTId=VAR_006432.
variant 173 - 173 L -> W (in AD3) /FTId=VAR_010125.
variant 174 - 174 L -> M (in AD3) /FTId=VAR_016217.
variant 205 - 205 F -> L (in dbSNP:rs1042864) /FTId=VAR_011876.
variant 206 - 206 G -> A (in AD3) /FTId=VAR_016218.
variant 209 - 209 G -> R (in AD3) /FTId=VAR_009210.
variant 209 - 209 G -> V (in AD3) /FTId=VAR_006433.
variant 213 - 213 I -> T (in AD3) /FTId=VAR_006434.
variant 219 - 219 L -> P (in AD3) /FTId=VAR_010126.
variant 231 - 231 A -> T (in AD3) /FTId=VAR_006435.
variant 231 - 231 A -> V (in AD3) /FTId=VAR_006436.
variant 233 - 233 M -> L (in AD3) /FTId=VAR_009211.
variant 233 - 233 M -> T (in AD3) /FTId=VAR_006437.
variant 235 - 235 L -> P (in A3D) /FTId=VAR_006438.
variant 246 - 246 A -> E (in AD3) /FTId=VAR_006439.
variant 250 - 250 L -> S (in AD3) /FTId=VAR_006440.
variant 260 - 260 A -> V (in AD3) /FTId=VAR_006441.
variant 262 - 262 L -> F (in AD3) /FTId=VAR_006442.
variant 263 - 263 C -> R (in AD3) /FTId=VAR_006443.
variant 264 - 264 P -> L (in AD3) /FTId=VAR_006444.
variant 266 - 266 G -> S (in AD3) /FTId=VAR_016219.
variant 267 - 267 P -> S (in AD3) /FTId=VAR_006445.
variant 267 - 267 P -> T (in AD3) /FTId=VAR_006446.
variant 269 - 269 R -> G (in AD3) /FTId=VAR_006447.
variant 269 - 269 R -> H (in AD3) /FTId=VAR_006448.
variant 271 - 271 L -> V (in AD3) /FTId=VAR_016220.
variant 278 - 278 R -> T (in AD3) /FTId=VAR_006449.
variant 280 - 280 E -> A (in AD3) /FTId=VAR_006450.
variant 280 - 280 E -> G (in AD3) /FTId=VAR_006451.
variant 282 - 282 L -> R (in AD3) /FTId=VAR_009212.
variant 285 - 285 A -> V (in AD3) /FTId=VAR_006452.
variant 286 - 286 L -> V (in AD3) /FTId=VAR_006453.
variant 289 - 289 S -> C (in AD3) /FTId=VAR_010127.
variant 318 - 318 E -> G (in dbSNP:rs17125721) /FTId=VAR_006454.
variant 378 - 378 G -> E (in AD3) /FTId=VAR_006455.
variant 384 - 384 G -> A (in AD3) /FTId=VAR_006456.
variant 390 - 390 S -> I (in AD3) /FTId=VAR_010128.
variant 392 - 392 L -> V (in AD3) /FTId=VAR_006457.
variant 405 - 405 N -> S (in AD3) /FTId=VAR_010129.
variant 409 - 409 A -> T (in AD3) /FTId=VAR_009213.
variant 410 - 410 C -> Y (in AD3; dbSNP:rs661) /FTId=VAR_006458.
variant 426 - 426 A -> P (in AD3) /FTId=VAR_006459.
variant 431 - 431 A -> E (in AD3) /FTId=VAR_025605.
variant 436 - 436 P -> Q (in AD3; dbSNP:rs28930977) /FTId=VAR_006460.
variant 436 - 436 P -> S (in AD3) /FTId=VAR_008141.
keyword 1 - 467 3D-structure
keyword 1 - 467 Alternative splicing
keyword 1 - 467 Alzheimer disease
keyword 1 - 467 Amyloidosis
keyword 1 - 467 Apoptosis
keyword 1 - 467 Cell adhesion
keyword 1 - 467 Complete proteome
keyword 1 - 467 Direct protein sequencing
keyword 1 - 467 Disease mutation
keyword 1 - 467 Endoplasmic reticulum
keyword 1 - 467 Golgi apparatus
keyword 1 - 467 Hydrolase
keyword 1 - 467 Membrane
keyword 1 - 467 Neurodegeneration
keyword 1 - 467 Notch signaling pathway
keyword 1 - 467 Phosphoprotein
keyword 1 - 467 Polymorphism
keyword 1 - 467 Protease
keyword 1 - 467 Transmembrane
keyword 1 - 467 Transmembrane helix
Molecular Weight 1 - 467 52668
1 hit 1 - 467 PF01080

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2014 LifeSpan BioSciences, Inc. All Rights Reserved