Human GATA6

Rabbit

Human (tested or 100% immunogen sequence identity)

IgG Polyclonal

Unconjugated. Also available conjugated with Biotin, FITC, HRP.

Immunogen affinity purified

Unmodified

Synthetic peptide within the region SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS of human GATA6(Q92908, NP_005248).

C-Terminus

Human GATA6

• IHC
• IHC - Paraffin (5 µg/ml)
• Western blot (0.2 - 1 µg/ml)

• Immunofluorescence

Immunohistochemistry: LS-B3483 was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration for LS-B3483 was determined to be 5 ug/ml. Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1:50000 - 100000 as second antibody. ELISA titer in peptide based assay: 1:312500.

PBS, 0.09% sodium azide, 2% sucrose

Short term: Store at 2-8°C for up to 1 week. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: Q92908 NCBI: NM_005257 NP_005248.2